Recombinant Schizosaccharomyces pombe Uncharacterized protein C23H3.12c (SPAC23H3.12c)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Uncharacterized protein C23H3.12c (SPAC23H3.12c) is a protein of the fission yeast Schizosaccharomyces pombe. The gene name is recorded as SPAC23H3.12c, and it is also referred to as Uncharacterized protein C23H3.12c .

Basic Properties

  • Source: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) .

  • UniProt ID: O13942

  • Sequence Length: The protein is a full length protein .

  • Amino Acid Sequence:
    MRIIALPLPNQRVFLHCYPSEYLAKKVTIHDKIINRIYKYWDSWSASKSYTKQKVVSLGN
    RILHATPYEENFLRAIAPVKKLNDTELHQTLYIEHPPNLESSTILAELNRSKQLQKTHTN
    YLIGNIIGLPLTIPFILIPLIPNIPGFYLCYRAYCNFRAIQGSIQLARVMSIENIQMQES
    EKLEKALKLFTNGDATPLNALIGHPDFVDRYKRAVAQEQRKSKIIK

Function and Cellular Role

As the name suggests, the protein is currently uncharacterized, meaning its precise function within Schizosaccharomyces pombe is not yet fully understood . Research indicates that many proteins within Schizosaccharomyces pombe are crucial for maintaining cell integrity and polarity, particularly through interactions with various signaling pathways and cell wall components .

Involvement in Cellular Processes

Schizosaccharomyces pombe possesses a complex cell wall mainly composed of glucose polysaccharides and a small portion of glycoproteins . These components form three layers next to the plasma membrane, maintaining the cell's structural integrity . Proteins such as SPAC23H3.12c may play a role in these processes.

Cell Wall Synthesis and Maintenance

The cell wall of Schizosaccharomyces pombe contains -glucans (28%) and -glucans (46 to 54%), with the latter further divided into linear -1,3-glucan, -1,6-branched--1,3-glucan, and a minor portion of -1,3-branched--1,6-glucan (now referred to as -1,6-glucan) . Proper cell wall construction is vital for the rigidity and shape of the fission yeast .

Protein Kinase C Homologues

Pck1p and Pck2p are protein kinase C homologues in Schizosaccharomyces pombe that interact with rho1p and rho2p when bound to GTP . These kinases are essential for maintaining cell integrity, and pck2p is involved in maintaining cell polarity .

Homologues and Related Proteins

While SPAC23H3.12c is an uncharacterized protein, studies on other Schizosaccharomyces pombe proteins provide a context for understanding its potential function.

Sup11p

Sup11p is essential for -1,6-glucan formation and proper septum assembly in Schizosaccharomyces pombe . A mutant with reduced sup11+ expression lacks -1,6-glucan and shows severe morphological defects .

Rad18

Rad18 is an essential gene involved in DNA repair . It is part of a high-molecular-weight complex with at least six other proteins .

Experimental Data

Recombinant forms of SPAC23H3.12c are available for experimental use, such as ELISA assays .

  • ELISA Recombinant Protein: Available as a recombinant protein for use in ELISA assays .

  • Quantity: Typically supplied in 50 µg quantities .

  • Storage: Recommended storage at -20℃, with working aliquots stored at 4℃ for up to one week . Repeated freezing and thawing should be avoided .

  • Expression Region: 1-226

Genetic Interactions

Genetic studies indicate interactions between various proteins involved in cell wall maintenance and signaling pathways.

  • pck1(+) and pck2(+) interact with cps1(+) and gls2(+), which are similar to Saccharomyces cerevisiae FKS1 and FKS2, encoding membrane subunits of (1-3)beta-D-glucan synthase .

  • pck1(+) also shows a genetic interaction with ras1(+) and ral1(+), suggesting a functional link between signaling pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPAC23H3.12c; Uncharacterized protein C23H3.12c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC23H3.12c
Target Protein Sequence
MRIIALPLPNQRVFLHCYPSEYLAKKVTIHDKIINRIYKYWDSWSASKSYTKQKVVSLGN RILHATPYEENFLRAIAPVKKLNDTELHQTLYIEHPPNLESSTILAELNRSKQLQKTHTN YLIGNIIGLPLTIPFILIPLIPNIPGFYLCYRAYCNFRAIQGSIQLARVMSIENIQMQES EKLEKALKLFTNGDATPLNALIGHPDFVDRYKRAVAQEQRKSKIIK
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the predicted structure of SPAC23H3.12c and how reliable is it?

SPAC23H3.12c has a computed structure model available in the RCSB PDB database (AF_AFO13942F1). This model was generated using AlphaFold and released to the AlphaFold DB on July 1, 2021, with the last modification on September 30, 2022. The model demonstrates high confidence with a global pLDDT score of 92.28, indicating very high reliability of the predicted structure . The protein consists of 226 amino acids and is derived from S. pombe strain 972 / ATCC 24843. The UniProtKB identifier for this protein is O13942 .

It's important to note that while the structure prediction has high confidence, there are currently no experimental data to verify the accuracy of this computed model. Researchers should consider this limitation when designing structure-based functional studies.

What approaches are recommended for expressing recombinant SPAC23H3.12c in heterologous systems?

Based on successful expression strategies for other S. pombe proteins, recombinant expression of SPAC23H3.12c can be achieved through several approaches:

  • Insect cell expression system: This approach has been successful for other S. pombe proteins as demonstrated in previous studies. The process typically involves:

    • Cloning the SPAC23H3.12c gene into an appropriate insect cell expression vector

    • Expression in insect cells followed by purification using affinity chromatography

  • E. coli expression system: Although not explicitly mentioned in the search results for this protein, E. coli systems are commonly used for recombinant protein expression. When using this system, researchers should consider:

    • Codon optimization for E. coli

    • Using solubility-enhancing fusion tags (e.g., MBP, SUMO)

    • Testing multiple expression conditions to optimize protein folding

  • S. pombe homologous expression: For proteins that are difficult to express in heterologous systems, expression in S. pombe itself may prove advantageous for proper folding and post-translational modifications.

The choice of expression system should be guided by the intended downstream applications and the requirement for post-translational modifications.

How can researchers determine if SPAC23H3.12c expression changes under stress conditions?

To investigate if SPAC23H3.12c is stress-responsive, researchers can employ global transcriptional analysis methods as described in previous studies:

  • Microarray or RNA-seq analysis: Compare expression levels of SPAC23H3.12c in control versus stressed cells. Previous studies have used spotted arrays to analyze RNA from deletion strains .

  • Quantitative RT-PCR: For targeted analysis, researchers can use real-time PCR to quantify SPAC23H3.12c expression levels before and after stress exposure .

  • Northern blot analysis: This technique can be useful for validating expression changes and identifying any alternative transcripts .

Based on patterns observed in other S. pombe genes, researchers should consider testing multiple stress conditions, including:

  • Environmental stresses (oxidative, heat shock, osmotic)

  • Nutrient limitation

  • Chemical stressors (such as sodium fluoride, which has been shown to trigger global gene expression changes in S. pombe)

The table below summarizes typical stress response patterns observed in some S. pombe genes that could serve as a comparison framework:

Gene CategoryTypical Fold ChangeCommon Stress Response
Up-stress genes1.1 - 3.2Increased expression under various stresses
Swi6-bound genes1.8 - 2.9Often showing heterochromatin regulation
Others1.0 - 1.2Minimal response to stress conditions

What bioinformatic approaches can help predict the function of SPAC23H3.12c?

For uncharacterized proteins like SPAC23H3.12c, a multi-faceted bioinformatic approach is recommended:

  • Sequence motif analysis: Investigate upstream intergenic regions (up to 1000 base pairs) for regulatory motifs that might provide functional clues. Tools like SPEXS can be useful for identifying statistically overrepresented sequence patterns .

  • Comparative genomics: Look for orthologs in related species to gain insights into conserved functions.

  • Co-expression analysis: Identify genes with similar expression patterns across conditions, as co-expressed genes often function in related pathways.

  • Protein domain prediction: Search for recognizable domains that might suggest molecular function.

  • Structural homology: Use the high-confidence structural model (pLDDT score of 92.28) to identify proteins with similar structural features but potentially low sequence similarity.

What methods are recommended for investigating if SPAC23H3.12c interacts with transcription elongation factors?

Given that some S. pombe proteins are involved in transcription elongation complexes like SpELL/SpEAF, investigating potential interactions between SPAC23H3.12c and these complexes would be valuable:

  • Co-immunoprecipitation (Co-IP): This approach can be used to identify proteins that physically interact with SPAC23H3.12c:

    • Generate strains expressing FLAG-tagged SPAC23H3.12c

    • Perform immunoprecipitation followed by mass spectrometry to identify interacting partners

    • Compare with known interactors of SpELL and SpEAF complexes

  • Chromatin Immunoprecipitation (ChIP): To determine if SPAC23H3.12c associates with chromatin:

    • Prepare chromatin extracts from tagged strains

    • Perform immunoprecipitation with appropriate antibodies

    • Analyze associated DNA regions by sequencing or PCR

  • Functional complementation assays: Test if SPAC23H3.12c can rescue phenotypes associated with deletion of known transcription elongation factors.

  • Transcription elongation assays: In vitro assays using purified recombinant proteins can determine if SPAC23H3.12c affects transcription elongation rates:

    • Prepare paused RNA Polymerase II elongation complexes

    • Test the effect of adding purified SPAC23H3.12c on elongation rates

    • Compare with the known effects of SpELL/SpEAF complex

How can researchers effectively perform ChIP-chip analysis to study SPAC23H3.12c chromatin associations?

ChIP-chip analysis is a powerful approach for genome-wide mapping of protein-DNA interactions. For SPAC23H3.12c, the following protocol is recommended:

  • Preparation of chromatin extracts:

    • Crosslink S. pombe cells expressing tagged SPAC23H3.12c using formaldehyde

    • Lyse cells and isolate chromatin

    • Sonicate to fragment DNA (aim for fragments of 200-500 bp)

  • Immunoprecipitation:

    • Use antibodies against the tag or against SPAC23H3.12c itself

    • Collect immunoprecipitated material and reverse crosslinks

    • Purify the associated DNA

  • Array hybridization and analysis:

    • Amplify and label the immunoprecipitated DNA

    • Hybridize to microarrays covering the S. pombe genome

    • Compare enrichment patterns with known transcription factors

  • Validation of binding sites:

    • Confirm selected binding sites using ChIP-qPCR

    • Correlate binding with expression data for nearby genes

Researchers should pay special attention to whether SPAC23H3.12c shows enrichment patterns similar to known transcription elongation factors like SpELL and SpEAF, which might suggest functional relationships.

What phenotypic analyses should be performed on SPAC23H3.12c deletion strains?

A comprehensive phenotypic analysis of SPAC23H3.12c deletion strains should include:

  • Growth assays under various conditions:

    • Standard growth conditions

    • Stress conditions (temperature, oxidative stress, nutrient limitation)

    • Sensitivity to 6-azauracil (a test for transcription elongation defects that has been used for ell1Δ strains)

  • Transcriptome analysis:

    • RNA preparation and analysis using spotted arrays to identify differentially expressed genes

    • Northern analysis to validate expression changes in selected genes

    • Analysis of 3' RNA ends to detect potential termination defects

  • Cell morphology and cell cycle progression:

    • Microscopic examination for morphological abnormalities

    • Cell cycle analysis to detect any phase-specific delays

  • Genetic interaction studies:

    • Construction of double mutants with known transcription factors

    • Synthetic genetic array analysis to identify functional pathways

Based on findings from other S. pombe genes, particular attention should be paid to potential roles in cell separation processes, as some uncharacterized proteins have been found to be involved in this process .

How can researchers determine if SPAC23H3.12c is involved in RNA polymerase II regulation?

To investigate potential roles of SPAC23H3.12c in RNA polymerase II regulation:

  • In vitro transcription assays:

    • Prepare RNA Polymerase II using established protocols

    • Conduct oligo(dC)-tailed template transcription assays with and without recombinant SPAC23H3.12c

    • Compare results with known transcription regulators like the SpELL/SpEAF complex

  • Paused elongation complex assays:

    • Prepare paused RNA Polymerase II elongation complexes

    • Test the effect of adding purified SPAC23H3.12c on elongation rate

    • Determine if SPAC23H3.12c affects pyrophosphorolysis (as the SpELL/SpEAF complex does)

  • Genome-wide Pol II occupancy:

    • Perform ChIP-seq with antibodies against RNA Pol II in wild-type and SPAC23H3.12c deletion strains

    • Analyze differences in Pol II distribution, particularly at longer genes or genes with high Pol II occupancy

  • Analysis of transcription-related phenotypes:

    • Test for sensitivity to transcription inhibitors

    • Examine effects on intron-containing genes, which might have specific transcriptional regulation requirements

What are the optimal protocols for purifying recombinant SPAC23H3.12c?

Based on successful purification strategies for other S. pombe proteins:

  • Expression system selection:

    • Insect cell expression systems have proven effective for S. pombe proteins

    • Consider E. coli or S. pombe expression systems as alternatives

  • Affinity tag strategy:

    • N-terminal or C-terminal His-tag for IMAC purification

    • FLAG-tag for immunoaffinity purification

    • Consider dual tagging strategies for tandem purification

  • Purification protocol:

    • Cell lysis using appropriate buffers

    • Initial capture on affinity resin

    • Intermediate purification using ion exchange chromatography

    • Final polishing using size exclusion chromatography

  • Quality control:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Mass spectrometry for definitive identification

    • Dynamic light scattering to assess homogeneity

    • Thermal shift assays to confirm proper folding

When purifying SPAC23H3.12c, researchers should optimize buffer conditions based on the predicted structural properties from the AlphaFold model with pLDDT score of 92.28 .

What is the recommended approach for constructing and validating SPAC23H3.12c deletion strains?

For efficient construction and validation of SPAC23H3.12c deletion strains:

  • Gene deletion strategy:

    • PCR-based gene targeting using selectable markers

    • Design primers with homology to regions flanking SPAC23H3.12c

    • Transform S. pombe with the deletion cassette

  • Screening transformants:

    • PCR verification of correct integration

    • Southern blotting for definitive confirmation

    • RT-PCR to confirm absence of SPAC23H3.12c transcript

  • Phenotypic validation:

    • Compare growth characteristics with wild-type strain

    • Test sensitivity to environmental stresses

    • Perform complementation tests by reintroducing SPAC23H3.12c

  • Genomic validation:

    • Whole-genome sequencing to rule out off-target mutations

    • Transcriptome analysis to identify compensatory mechanisms

The deletion strain construction should follow established protocols that have been used for similar studies in S. pombe .

What methods are most effective for studying the subcellular localization of SPAC23H3.12c?

To determine the subcellular localization of SPAC23H3.12c:

  • Fluorescent protein tagging:

    • C-terminal or N-terminal GFP tagging of the endogenous SPAC23H3.12c gene

    • Verification of tag functionality through complementation tests

    • Live-cell fluorescence microscopy under various conditions

  • Immunofluorescence microscopy:

    • Generate antibodies against SPAC23H3.12c or use antibodies against a tag

    • Fix and permeabilize cells

    • Co-staining with organelle markers for precise localization

  • Subcellular fractionation:

    • Prepare nuclear, cytosolic, and membrane fractions

    • Analyze presence of SPAC23H3.12c in each fraction by Western blotting

    • Compare distribution with known marker proteins

  • Time-lapse microscopy:

    • Track localization changes during cell cycle or stress responses

    • Correlate with functional roles in specific cellular processes

Based on findings for other transcription-related proteins, special attention should be paid to potential nuclear localization and chromatin association .

How should researchers analyze gene expression data to understand SPAC23H3.12c function?

For comprehensive analysis of gene expression data related to SPAC23H3.12c:

  • Differential expression analysis:

    • Compare wild-type and SPAC23H3.12c deletion strains

    • Identify significantly up- and down-regulated genes

    • Group genes based on expression patterns across conditions

  • Gene Ontology enrichment analysis:

    • Identify biological processes over-represented among differentially expressed genes

    • Look for enrichment of genes involved in cell separation, as this has been associated with some SpELL/SpEAF regulated genes

  • Gene length and expression level correlation:

    • Analyze if SPAC23H3.12c preferentially affects longer genes

    • Examine if gene length correlates with expression changes in deletion strains

  • RNA Polymerase II occupancy analysis:

    • Correlate gene expression changes with Pol II occupancy

    • Determine if SPAC23H3.12c affects genes with high Pol II occupancy

The table below shows the type of analysis framework that could be used:

Analysis ParameterWild-typeSPAC23H3.12c DeletionStatistical Significance
Average gene length of affected genesX bpY bpp-value
Mean Pol II occupancy of affected genesX unitsY unitsp-value
Enrichment of cell separation genesX%Y%p-value
Intron-containing genes affectedX%Y%p-value

What approaches are recommended for identifying the regulatory network involving SPAC23H3.12c?

To elucidate the regulatory network involving SPAC23H3.12c:

  • Motif discovery in promoter regions:

    • Extract upstream intergenic regions of genes affected by SPAC23H3.12c deletion

    • Use tools like SPEXS to identify overrepresented sequence motifs

    • Compare with known transcription factor binding sites

  • Protein-protein interaction network analysis:

    • Integrate co-immunoprecipitation data with existing protein interaction databases

    • Construct a protein interaction network centered on SPAC23H3.12c

    • Identify key hubs and modules within the network

  • Integration with chromatin association data:

    • Correlate ChIP-chip or ChIP-seq data with expression changes

    • Identify direct vs. indirect regulatory effects

    • Map the distribution of SPAC23H3.12c across coding regions

  • Comparative analysis with related complexes:

    • Compare SPAC23H3.12c regulatory network with that of SpELL/SpEAF complex

    • Identify overlapping and distinct target genes

    • Determine if SPAC23H3.12c shows functional redundancy with known factors

How can researchers use evolutionary approaches to gain insights into SPAC23H3.12c function?

Evolutionary analysis can provide crucial insights into SPAC23H3.12c function:

  • Ortholog identification and analysis:

    • Identify orthologs in related yeast species and other eukaryotes

    • Compare sequence conservation across different domains of the protein

    • Correlate domain conservation with predicted structural features from the AlphaFold model

  • Synteny analysis:

    • Examine conservation of genomic context around SPAC23H3.12c

    • Identify co-evolved gene clusters that might suggest functional relationships

  • Evolutionary rate analysis:

    • Calculate evolutionary rates across different parts of the protein

    • Identify regions under purifying or positive selection

    • Correlate with structural features from the AlphaFold model (pLDDT score: 92.28)

  • Ancestral sequence reconstruction:

    • Reconstruct the evolutionary history of SPAC23H3.12c

    • Identify critical mutations that may have altered function during evolution

This evolutionary perspective can provide a broader context for understanding the protein's role in fundamental cellular processes.

What functional genomics approaches can help determine if SPAC23H3.12c is involved in stress response?

To investigate potential roles in stress response:

  • Comparative stress response profiling:

    • Subject wild-type and SPAC23H3.12c deletion strains to various stresses

    • Perform global gene expression analysis

    • Compare with known stress response patterns in S. pombe

  • Phenotypic analysis under stress conditions:

    • Measure growth rates under various stresses

    • Examine cell morphology and viability

    • Compare with phenotypes of deletion strains for known stress response genes

  • Integration with stress-responsive transcriptome data:

    • Compare SPAC23H3.12c expression patterns with those of known stress-responsive genes like those up-regulated under stress conditions (with fold changes typically between 1.1-3.2)

    • Determine if SPAC23H3.12c is co-regulated with specific stress response pathways

  • Chemical genetics approach:

    • Screen for chemicals that produce differential growth effects in wild-type vs. deletion strains

    • Focus on compounds known to induce specific stress responses, such as sodium fluoride which has been shown to induce global gene expression changes in S. pombe

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.