Recombinant Schizosaccharomyces pombe Uncharacterized protein C23H3.12c (SPAC23H3.12c) is a protein of the fission yeast Schizosaccharomyces pombe. The gene name is recorded as SPAC23H3.12c, and it is also referred to as Uncharacterized protein C23H3.12c .
Source: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) .
Amino Acid Sequence:
MRIIALPLPNQRVFLHCYPSEYLAKKVTIHDKIINRIYKYWDSWSASKSYTKQKVVSLGN
RILHATPYEENFLRAIAPVKKLNDTELHQTLYIEHPPNLESSTILAELNRSKQLQKTHTN
YLIGNIIGLPLTIPFILIPLIPNIPGFYLCYRAYCNFRAIQGSIQLARVMSIENIQMQES
EKLEKALKLFTNGDATPLNALIGHPDFVDRYKRAVAQEQRKSKIIK
As the name suggests, the protein is currently uncharacterized, meaning its precise function within Schizosaccharomyces pombe is not yet fully understood . Research indicates that many proteins within Schizosaccharomyces pombe are crucial for maintaining cell integrity and polarity, particularly through interactions with various signaling pathways and cell wall components .
Schizosaccharomyces pombe possesses a complex cell wall mainly composed of glucose polysaccharides and a small portion of glycoproteins . These components form three layers next to the plasma membrane, maintaining the cell's structural integrity . Proteins such as SPAC23H3.12c may play a role in these processes.
The cell wall of Schizosaccharomyces pombe contains -glucans (28%) and -glucans (46 to 54%), with the latter further divided into linear -1,3-glucan, -1,6-branched--1,3-glucan, and a minor portion of -1,3-branched--1,6-glucan (now referred to as -1,6-glucan) . Proper cell wall construction is vital for the rigidity and shape of the fission yeast .
Pck1p and Pck2p are protein kinase C homologues in Schizosaccharomyces pombe that interact with rho1p and rho2p when bound to GTP . These kinases are essential for maintaining cell integrity, and pck2p is involved in maintaining cell polarity .
While SPAC23H3.12c is an uncharacterized protein, studies on other Schizosaccharomyces pombe proteins provide a context for understanding its potential function.
Sup11p is essential for -1,6-glucan formation and proper septum assembly in Schizosaccharomyces pombe . A mutant with reduced sup11+ expression lacks -1,6-glucan and shows severe morphological defects .
Rad18 is an essential gene involved in DNA repair . It is part of a high-molecular-weight complex with at least six other proteins .
Recombinant forms of SPAC23H3.12c are available for experimental use, such as ELISA assays .
ELISA Recombinant Protein: Available as a recombinant protein for use in ELISA assays .
Storage: Recommended storage at -20℃, with working aliquots stored at 4℃ for up to one week . Repeated freezing and thawing should be avoided .
Genetic studies indicate interactions between various proteins involved in cell wall maintenance and signaling pathways.
pck1(+) and pck2(+) interact with cps1(+) and gls2(+), which are similar to Saccharomyces cerevisiae FKS1 and FKS2, encoding membrane subunits of (1-3)beta-D-glucan synthase .
pck1(+) also shows a genetic interaction with ras1(+) and ral1(+), suggesting a functional link between signaling pathways .
KEGG: spo:SPAC23H3.12c
STRING: 4896.SPAC23H3.12c.1
SPAC23H3.12c has a computed structure model available in the RCSB PDB database (AF_AFO13942F1). This model was generated using AlphaFold and released to the AlphaFold DB on July 1, 2021, with the last modification on September 30, 2022. The model demonstrates high confidence with a global pLDDT score of 92.28, indicating very high reliability of the predicted structure . The protein consists of 226 amino acids and is derived from S. pombe strain 972 / ATCC 24843. The UniProtKB identifier for this protein is O13942 .
It's important to note that while the structure prediction has high confidence, there are currently no experimental data to verify the accuracy of this computed model. Researchers should consider this limitation when designing structure-based functional studies.
Based on successful expression strategies for other S. pombe proteins, recombinant expression of SPAC23H3.12c can be achieved through several approaches:
Insect cell expression system: This approach has been successful for other S. pombe proteins as demonstrated in previous studies. The process typically involves:
E. coli expression system: Although not explicitly mentioned in the search results for this protein, E. coli systems are commonly used for recombinant protein expression. When using this system, researchers should consider:
Codon optimization for E. coli
Using solubility-enhancing fusion tags (e.g., MBP, SUMO)
Testing multiple expression conditions to optimize protein folding
S. pombe homologous expression: For proteins that are difficult to express in heterologous systems, expression in S. pombe itself may prove advantageous for proper folding and post-translational modifications.
The choice of expression system should be guided by the intended downstream applications and the requirement for post-translational modifications.
To investigate if SPAC23H3.12c is stress-responsive, researchers can employ global transcriptional analysis methods as described in previous studies:
Microarray or RNA-seq analysis: Compare expression levels of SPAC23H3.12c in control versus stressed cells. Previous studies have used spotted arrays to analyze RNA from deletion strains .
Quantitative RT-PCR: For targeted analysis, researchers can use real-time PCR to quantify SPAC23H3.12c expression levels before and after stress exposure .
Northern blot analysis: This technique can be useful for validating expression changes and identifying any alternative transcripts .
Based on patterns observed in other S. pombe genes, researchers should consider testing multiple stress conditions, including:
Environmental stresses (oxidative, heat shock, osmotic)
Nutrient limitation
Chemical stressors (such as sodium fluoride, which has been shown to trigger global gene expression changes in S. pombe)
The table below summarizes typical stress response patterns observed in some S. pombe genes that could serve as a comparison framework:
| Gene Category | Typical Fold Change | Common Stress Response |
|---|---|---|
| Up-stress genes | 1.1 - 3.2 | Increased expression under various stresses |
| Swi6-bound genes | 1.8 - 2.9 | Often showing heterochromatin regulation |
| Others | 1.0 - 1.2 | Minimal response to stress conditions |
For uncharacterized proteins like SPAC23H3.12c, a multi-faceted bioinformatic approach is recommended:
Sequence motif analysis: Investigate upstream intergenic regions (up to 1000 base pairs) for regulatory motifs that might provide functional clues. Tools like SPEXS can be useful for identifying statistically overrepresented sequence patterns .
Comparative genomics: Look for orthologs in related species to gain insights into conserved functions.
Co-expression analysis: Identify genes with similar expression patterns across conditions, as co-expressed genes often function in related pathways.
Protein domain prediction: Search for recognizable domains that might suggest molecular function.
Structural homology: Use the high-confidence structural model (pLDDT score of 92.28) to identify proteins with similar structural features but potentially low sequence similarity.
Given that some S. pombe proteins are involved in transcription elongation complexes like SpELL/SpEAF, investigating potential interactions between SPAC23H3.12c and these complexes would be valuable:
Co-immunoprecipitation (Co-IP): This approach can be used to identify proteins that physically interact with SPAC23H3.12c:
Chromatin Immunoprecipitation (ChIP): To determine if SPAC23H3.12c associates with chromatin:
Functional complementation assays: Test if SPAC23H3.12c can rescue phenotypes associated with deletion of known transcription elongation factors.
Transcription elongation assays: In vitro assays using purified recombinant proteins can determine if SPAC23H3.12c affects transcription elongation rates:
ChIP-chip analysis is a powerful approach for genome-wide mapping of protein-DNA interactions. For SPAC23H3.12c, the following protocol is recommended:
Preparation of chromatin extracts:
Immunoprecipitation:
Array hybridization and analysis:
Validation of binding sites:
Researchers should pay special attention to whether SPAC23H3.12c shows enrichment patterns similar to known transcription elongation factors like SpELL and SpEAF, which might suggest functional relationships.
A comprehensive phenotypic analysis of SPAC23H3.12c deletion strains should include:
Growth assays under various conditions:
Transcriptome analysis:
Cell morphology and cell cycle progression:
Microscopic examination for morphological abnormalities
Cell cycle analysis to detect any phase-specific delays
Genetic interaction studies:
Construction of double mutants with known transcription factors
Synthetic genetic array analysis to identify functional pathways
Based on findings from other S. pombe genes, particular attention should be paid to potential roles in cell separation processes, as some uncharacterized proteins have been found to be involved in this process .
To investigate potential roles of SPAC23H3.12c in RNA polymerase II regulation:
In vitro transcription assays:
Paused elongation complex assays:
Genome-wide Pol II occupancy:
Analysis of transcription-related phenotypes:
Based on successful purification strategies for other S. pombe proteins:
Expression system selection:
Affinity tag strategy:
Purification protocol:
Quality control:
SDS-PAGE and Western blotting to confirm purity and identity
Mass spectrometry for definitive identification
Dynamic light scattering to assess homogeneity
Thermal shift assays to confirm proper folding
When purifying SPAC23H3.12c, researchers should optimize buffer conditions based on the predicted structural properties from the AlphaFold model with pLDDT score of 92.28 .
For efficient construction and validation of SPAC23H3.12c deletion strains:
Gene deletion strategy:
Screening transformants:
Phenotypic validation:
Compare growth characteristics with wild-type strain
Test sensitivity to environmental stresses
Perform complementation tests by reintroducing SPAC23H3.12c
Genomic validation:
The deletion strain construction should follow established protocols that have been used for similar studies in S. pombe .
To determine the subcellular localization of SPAC23H3.12c:
Fluorescent protein tagging:
C-terminal or N-terminal GFP tagging of the endogenous SPAC23H3.12c gene
Verification of tag functionality through complementation tests
Live-cell fluorescence microscopy under various conditions
Immunofluorescence microscopy:
Generate antibodies against SPAC23H3.12c or use antibodies against a tag
Fix and permeabilize cells
Co-staining with organelle markers for precise localization
Subcellular fractionation:
Prepare nuclear, cytosolic, and membrane fractions
Analyze presence of SPAC23H3.12c in each fraction by Western blotting
Compare distribution with known marker proteins
Time-lapse microscopy:
Track localization changes during cell cycle or stress responses
Correlate with functional roles in specific cellular processes
Based on findings for other transcription-related proteins, special attention should be paid to potential nuclear localization and chromatin association .
For comprehensive analysis of gene expression data related to SPAC23H3.12c:
Differential expression analysis:
Gene Ontology enrichment analysis:
Gene length and expression level correlation:
RNA Polymerase II occupancy analysis:
The table below shows the type of analysis framework that could be used:
| Analysis Parameter | Wild-type | SPAC23H3.12c Deletion | Statistical Significance |
|---|---|---|---|
| Average gene length of affected genes | X bp | Y bp | p-value |
| Mean Pol II occupancy of affected genes | X units | Y units | p-value |
| Enrichment of cell separation genes | X% | Y% | p-value |
| Intron-containing genes affected | X% | Y% | p-value |
To elucidate the regulatory network involving SPAC23H3.12c:
Motif discovery in promoter regions:
Protein-protein interaction network analysis:
Integrate co-immunoprecipitation data with existing protein interaction databases
Construct a protein interaction network centered on SPAC23H3.12c
Identify key hubs and modules within the network
Integration with chromatin association data:
Comparative analysis with related complexes:
Evolutionary analysis can provide crucial insights into SPAC23H3.12c function:
Ortholog identification and analysis:
Synteny analysis:
Examine conservation of genomic context around SPAC23H3.12c
Identify co-evolved gene clusters that might suggest functional relationships
Evolutionary rate analysis:
Ancestral sequence reconstruction:
Reconstruct the evolutionary history of SPAC23H3.12c
Identify critical mutations that may have altered function during evolution
This evolutionary perspective can provide a broader context for understanding the protein's role in fundamental cellular processes.
To investigate potential roles in stress response:
Comparative stress response profiling:
Phenotypic analysis under stress conditions:
Measure growth rates under various stresses
Examine cell morphology and viability
Compare with phenotypes of deletion strains for known stress response genes
Integration with stress-responsive transcriptome data:
Chemical genetics approach: