Recombinant Schizosaccharomyces pombe Uncharacterized protein C24B11.08c (SPAC24B11.08c)

What is SPAC24B11.08c and what are its basic characteristics?

SPAC24B11.08c is an uncharacterized protein from the fission yeast Schizosaccharomyces pombe. It is a full-length protein consisting of 390 amino acids with a UniProt identifier of Q09895 . This protein is classified among hypothetical proteins (HPs), which are proteins predicted to be expressed from an open reading frame that make up a substantial fraction of proteomes in both prokaryotes and eukaryotes . Based on its amino acid sequence and preliminary analyses, SPAC24B11.08c appears to have transmembrane elements, suggesting it may be a membrane-associated protein, as indicated by hydrophobic regions in its sequence (LIVIFIVLMEWINYRRVIAVHEIIV) . The primary structure indicates multiple cysteine residues that may be involved in disulfide bond formation or metal coordination.

What expression systems are typically used for SPAC24B11.08c production?

Recombinant SPAC24B11.08c is predominantly expressed in E. coli expression systems with an N-terminal His-tag for purification purposes . The bacterial expression system is preferred due to its cost-effectiveness and high yield for research-scale protein production. The expression protocol typically involves transforming the coding sequence into a suitable E. coli strain, followed by induction of protein expression, cell lysis, and purification via metal affinity chromatography utilizing the His-tag. For researchers working with this protein, it's important to note that while E. coli provides good yields, eukaryotic post-translational modifications will be absent, which may impact functional studies if such modifications are biologically relevant to SPAC24B11.08c activity .

What are the optimal storage conditions for recombinant SPAC24B11.08c?

The recombinant SPAC24B11.08c protein should be stored at -20°C or -80°C for extended storage stability . The protein is typically provided in Tris-based buffer with either 6% trehalose (pH 8.0) or 50% glycerol to prevent freeze-thaw damage . For working stocks, aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of structural integrity . When reconstituting lyophilized protein, it is recommended to centrifuge the vial briefly before opening to bring the contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of a 0.1-1.0 mg/mL, and the addition of 5-50% glycerol (final concentration) is advised before aliquoting for long-term storage .

How should researchers approach structural characterization of SPAC24B11.08c?

Structural characterization of SPAC24B11.08c presents challenges common to uncharacterized proteins, especially those with potential membrane-spanning regions. A multi-technique approach is recommended, beginning with computational prediction methods to identify domains, secondary structure elements, and transmembrane regions. For experimental validation, researchers should consider:

• Circular Dichroism (CD) spectroscopy to determine secondary structure composition

• Limited proteolysis coupled with mass spectrometry to identify domain boundaries

• X-ray crystallography, though this may be challenging if the protein contains membrane domains

• Cryo-electron microscopy, particularly suitable for membrane proteins

• Nuclear Magnetic Resonance (NMR) for smaller domains or fragments of the protein

The hydrophobic regions in SPAC24B11.08c's sequence (LIVIFIVLMEWINYRRVIAVHEIIV) suggest membrane association, which would necessitate special consideration in structural studies, possibly requiring detergents or lipid nanodiscs to maintain proper folding . Additionally, the presence of multiple cysteine residues suggests potential disulfide bonds that may be critical for correct folding and should be preserved during purification and analysis.

What approaches can be employed for functional characterization of SPAC24B11.08c?

Functional characterization of an uncharacterized protein like SPAC24B11.08c requires a systematic approach combining computational predictions with experimental validation:

• Sequence-based analysis: Employ bioinformatics tools to predict functional domains, conserved motifs, and phylogenetic relationships with proteins of known function.

• Gene knockout/knockdown studies: Generate SPAC24B11.08c deletion mutants in S. pombe and assess phenotypic changes under various growth conditions to determine essentiality and general functional roles.

• Protein interaction studies: Implement yeast two-hybrid screens, co-immunoprecipitation, or proximity labeling techniques to identify binding partners that may provide functional context.

• Localization studies: Use fluorescently-tagged versions of SPAC24B11.08c to determine subcellular localization, which can provide clues about function.

• Expression profiling: Analyze expression patterns of SPAC24B11.08c under different conditions using RNA-seq or proteomics to identify conditions where the protein may play critical roles.

The presence of cysteine-rich domains (GAAECGDCYGAADFAPEDTPGCCNTCDAVRDAYGKAHWRIG) suggests potential metal binding or catalytic functions that should be specifically investigated using metal-binding assays or enzymatic activity screens .

How can mass spectrometry contribute to SPAC24B11.08c characterization?

Mass spectrometry (MS) offers powerful approaches for characterizing uncharacterized proteins like SPAC24B11.08c across multiple dimensions:

• Protein identification and validation: MS can confirm the identity and integrity of recombinant SPAC24B11.08c preparations by matching peptide fragments to the expected sequence.

• Post-translational modifications (PTMs): MS can identify and map PTMs such as phosphorylation, glycosylation, or acetylation that may be critical for protein function.

• Protein-protein interactions: Affinity purification coupled with MS (AP-MS) can identify interaction partners of SPAC24B11.08c in its native cellular context.

• Structural insights: Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide information about protein dynamics and solvent accessibility of different regions.

• Quantitative proteomics: MS-based approaches can quantify changes in SPAC24B11.08c expression levels under different conditions.

As noted in the literature, mass spectrometry serves as a critical validation tool for protein characterization studies, particularly for hypothetical proteins where functional annotations are lacking . For SPAC24B11.08c specifically, researchers should develop targeted MS methods to analyze the protein's abundance in different cellular compartments, which may provide additional functional insights.

What bioinformatic approaches are recommended for predicting SPAC24B11.08c function?

Prediction of function for uncharacterized proteins requires sophisticated computational approaches that integrate multiple types of evidence:

• Sequence-based predictions: Begin with BLAST, HMM searches, and motif identification against conserved domain databases to identify functional elements.

• Structural prediction and modeling: Employ AlphaFold, RoseTTAFold, or I-TASSER to generate structural models that can be compared to proteins with known functions.

• Network-based approaches: Analyze protein-protein interaction networks, gene co-expression data, and genetic interaction screens to place SPAC24B11.08c in functional contexts.

• Evolutionary analysis: Calculate sequence conservation patterns across species to identify functionally important residues and domains.

• Integrated functional prediction: Use tools that combine multiple lines of evidence (e.g., STRING, SIFTER, COFACTOR) to generate comprehensive functional hypotheses.

For SPAC24B11.08c specifically, the presence of transmembrane regions and cysteine-rich domains suggests potential functions in membrane transport, signaling, or redox processes that should receive particular attention in computational analyses . The functional annotation challenges for hypothetical proteins require rigorous computational approaches followed by experimental validation, as highlighted in reviews on uncharacterized protein annotation .

What experimental designs are most effective for investigating SPAC24B11.08c protein-protein interactions?

Investigating protein-protein interactions for SPAC24B11.08c requires carefully designed experiments that account for its potential membrane association:

• Yeast two-hybrid (Y2H): Standard Y2H may be challenging for membrane proteins, but split-ubiquitin Y2H variants designed for membrane proteins would be appropriate.

• Affinity purification-mass spectrometry (AP-MS): This approach should employ:

  • Mild detergents for membrane protein solubilization

  • Crosslinking to capture transient interactions

  • Negative controls to filter out non-specific binding

• Proximity labeling (BioID or APEX): These methods are particularly valuable for membrane proteins, as they label nearby proteins regardless of physical interaction strength.

• Co-immunoprecipitation (Co-IP): When using Co-IP, researchers should:

  • Optimize detergent conditions for effective solubilization without disrupting interactions

  • Use both N- and C-terminal tags to account for potential accessibility issues

  • Include appropriate controls for tag-specific artifacts

• Fluorescence resonance energy transfer (FRET): For investigating interactions in living cells, FRET between fluorescently-tagged proteins can provide spatial and temporal information.

Given that SPAC24B11.08c appears to have both transmembrane regions and potential functional domains, a combination of approaches targeting different regions of the protein would yield the most comprehensive interaction data .

How can CRISPR-Cas9 technology be applied to study SPAC24B11.08c function in S. pombe?

CRISPR-Cas9 technology offers powerful approaches for studying uncharacterized proteins in their native context:

• Gene deletion: Complete knockout of SPAC24B11.08c to assess its essentiality and observe phenotypic consequences across different growth conditions.

• Domain-specific mutations: Introduction of precise mutations in predicted functional domains to assess their importance:

  • Target the cysteine-rich regions (GAAECGDCYGAADFAPEDTPGCCNTCDAVRDAYGK)

  • Modify potential transmembrane domains

  • Alter predicted phosphorylation or glycosylation sites

• Endogenous tagging: Adding fluorescent or affinity tags to the endogenous locus to study localization and interactions without overexpression artifacts.

• Conditional regulation: Creating conditional alleles (e.g., auxin-inducible degron systems) to study temporal aspects of SPAC24B11.08c function.

• CRISPRi approaches: For essential genes, CRISPR interference can achieve partial knockdown rather than complete knockout.

When implementing CRISPR-Cas9 in S. pombe for studying SPAC24B11.08c, researchers should select guide RNAs carefully to minimize off-target effects and design repair templates that include selectable markers for efficient screening of edited cells. The resulting mutant strains should be characterized under various stress conditions to identify phenotypes that may reveal functional roles of this uncharacterized protein.

What are common challenges in recombinant expression and purification of SPAC24B11.08c?

Researchers working with SPAC24B11.08c face several challenges during recombinant protein production and purification:

• Solubility issues: The hydrophobic regions in SPAC24B11.08c may cause aggregation when expressed in E. coli. Potential solutions include:

  • Using specialized E. coli strains designed for membrane proteins

  • Employing fusion tags that enhance solubility (e.g., MBP, SUMO)

  • Optimizing induction conditions (lower temperature, reduced IPTG concentration)

  • Adding detergents during cell lysis and purification

• Proper folding: The multiple cysteine residues in SPAC24B11.08c suggest potential disulfide bonds that may not form correctly in the reducing environment of E. coli cytoplasm. Strategies to address this include:

  • Expression in the periplasm using appropriate signal sequences

  • Co-expression with disulfide isomerases

  • Use of E. coli strains with oxidizing cytoplasm (e.g., SHuffle)

• Purification challenges: The current purification approach using His-tag affinity chromatography may benefit from:

  • Additional purification steps such as ion exchange or size exclusion chromatography

  • Optimization of imidazole concentration in elution buffers

  • Special attention to detergent selection and concentration

• Stability concerns: Once purified, the protein may exhibit limited stability. The current recommendation of 6% trehalose or 50% glycerol in storage buffers should be empirically verified, and researchers should test alternative stabilizing additives if needed.

How can inconsistent experimental results with SPAC24B11.08c be addressed?

When working with an uncharacterized protein like SPAC24B11.08c, researchers often encounter inconsistent experimental results. Several strategies can help address this challenge:

• Quality control measures:

  • Implement routine SDS-PAGE and western blotting to verify protein integrity

  • Use mass spectrometry to confirm protein identity and detect degradation

  • Assess protein folding using circular dichroism or fluorescence spectroscopy

  • Develop activity assays (if function is hypothesized) to confirm biological activity

• Standardization protocols:

  • Establish consistent expression and purification protocols

  • Create standard operating procedures for storage and handling

  • Use the same batch of protein for comparative experiments

  • Include known controls in all experimental setups

• Environmental variables:

  • Control temperature, pH, and ionic strength precisely

  • Document and standardize buffer compositions

  • Consider the impact of freeze-thaw cycles on protein activity

  • Test for metal ion dependencies if the cysteine-rich regions suggest metal binding

• Data analysis approaches:

  • Implement statistical methods appropriate for small sample sizes

  • Use technical and biological replicates appropriately

  • Consider bayesian approaches for integrating inconsistent data

  • Maintain detailed laboratory records to identify sources of variation

Addressing inconsistencies requires systematic troubleshooting and careful documentation of all experimental conditions, particularly for an uncharacterized protein where expected results and behaviors are not well established.

What emerging technologies show promise for SPAC24B11.08c characterization?

Several cutting-edge technologies are particularly promising for advancing our understanding of uncharacterized proteins like SPAC24B11.08c:

• Cryo-electron microscopy (Cryo-EM): The resolution revolution in cryo-EM has made it particularly valuable for membrane proteins that are challenging to crystallize. For SPAC24B11.08c, cryo-EM could provide structural insights even if the protein is difficult to crystallize due to its hydrophobic regions.

• AlphaFold and other AI structure prediction tools: These computational approaches can generate high-confidence structural models that can guide experimental design and functional hypothesis generation for SPAC24B11.08c.

• Single-cell proteomics: This emerging technology could reveal cell-to-cell variation in SPAC24B11.08c expression and localization that might be missed in population-averaged studies.

• Proximity labeling advances: Newer variants of BioID and APEX with improved spatial and temporal resolution could provide more precise mapping of SPAC24B11.08c's protein interaction neighborhood.

• CRISPR base editing and prime editing: These refined CRISPR technologies allow for precise point mutations without double-strand breaks, enabling more subtle functional analyses of specific amino acids within SPAC24B11.08c.

• Native mass spectrometry: This technique can analyze intact protein complexes, potentially revealing the stoichiometry and composition of complexes involving SPAC24B11.08c.

These technologies, when applied systematically to SPAC24B11.08c, could significantly accelerate our understanding of this uncharacterized protein and similar challenging targets .

How might integrating multi-omics data enhance understanding of SPAC24B11.08c function?

A comprehensive multi-omics approach can provide synergistic insights into the function of uncharacterized proteins like SPAC24B11.08c:

• Genomics: Comparative genomics across yeast species can reveal conservation patterns and genomic context that may suggest function. For SPAC24B11.08c, analysis of synteny and gene neighborhood across fungal species might reveal functional associations.

• Transcriptomics: RNA-seq data examining when and where SPAC24B11.08c is expressed can provide clues about its biological role. Particular attention should be paid to expression changes during:

  • Cell cycle progression

  • Response to various stresses

  • Different growth conditions

  • Developmental transitions

• Proteomics: Mass spectrometry-based proteomics can identify:

  • Post-translational modifications on SPAC24B11.08c

  • Protein-protein interactions

  • Changes in protein abundance under different conditions

  • Subcellular localization

• Metabolomics: Changes in metabolite profiles when SPAC24B11.08c is deleted or overexpressed may provide functional clues, particularly if it functions in metabolic processes.

• Integration strategies: Computational approaches to integrate these diverse data types include:

  • Network-based methods that identify functional modules

  • Machine learning approaches that predict function from multi-modal data

  • Bayesian integration that weights evidence based on reliability

The cysteine-rich domains and transmembrane regions of SPAC24B11.08c suggest potential roles in redox processes, metal binding, or membrane transport that should be specifically investigated in multi-omics analyses . As noted in reviews on uncharacterized proteins, systems-wide studies of proteins and their interactions are particularly valuable for revealing functions of hypothetical proteins .