Recombinant Schizosaccharomyces pombe Uncharacterized protein C27.05 (SPBC27.05)

Shipped with Ice Packs
In Stock

Description

Key Identifiers and Attributes

SPBC27.05 is annotated as an uncharacterized protein in S. pombe genomic databases. Its genetic and biochemical features are summarized in Table 1.

ParameterValue
Gene NameSPBC27.05
KEGG Identifierspo:SPBC27.05
STRING Protein ID4896.SPBC27.05.1
Source OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Recombinant HostEscherichia coli (in vitro expression system)
Expression SystemIn vitro bacterial production
PurityHigh-purity product (>90% as determined by SDS-PAGE)
Storage BufferTris/PBS-based buffer (pH 8.0)
Storage Conditions-20°C or -80°C (avoid repeated freeze-thaw cycles)

Recombinant Protein Synthesis

SPBC27.05 is produced via heterologous expression in E. coli, leveraging established bacterial systems for recombinant protein production. While specific details about the expression vector or induction conditions are not publicly disclosed, general methodologies align with well-established protocols:

  • Host Strain: Likely utilizes E. coli strains optimized for disulfide bond formation or rare codon usage (e.g., BL21(DE3) or derivatives) .

  • Purification: Commonly employs affinity chromatography (e.g., His-tagged protein purification) followed by size-exclusion chromatography for high-purity isolation .

Quality Control and Validation

  • Purity Validation: SDS-PAGE analysis confirms >90% purity .

  • Functional Validation: Antibodies specific to SPBC27.05 are available for immunological assays (e.g., Western blotting, immunoprecipitation) to confirm protein integrity and localization .

Experimental Utility

Despite its uncharacterized status, SPBC27.05 serves as a candidate for functional genomics and proteomics studies. Key tools and applications include:

ApplicationDescription
Antibody-Based AssaysCustom antibodies (e.g., CSB-PA873773XA01SXV) enable detection and localization studies .
Protein-Protein Interaction (PPI) StudiesRecombinant protein facilitates pulldown assays to identify interacting partners.
Structural AnalysisHigh-purity protein suitable for X-ray crystallography or NMR spectroscopy.

Functional Elucidation

SPBC27.05 lacks annotated biological roles, highlighting the need for targeted studies:

  • Hypothesis Testing: Potential involvement in stress response, metabolism, or chromatin dynamics (inferred from S. pombe genome context).

  • Comparative Genomics: Homologs in other organisms (e.g., Saccharomyces cerevisiae) may provide functional clues.

Technical Considerations

  • Expression Optimization: Codon bias adjustment or chaperone co-expression may enhance yield in E. coli .

  • Annotation Gaps: Public databases lack experimental data, necessitating primary research to assign function.

Recombinant Protein and Antibody Availability

SPBC27.05 is commercially available as a purified recombinant protein and as a target for custom antibody development:

ResourceProviderKey Features
Recombinant ProteinCusabio (CSB-CF873773SXV)In vitro E. coli expression; high-purity product .
Custom AntibodiesCusabio (CSB-PA873773XA01SXV)Rabbit-derived; validated for specificity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPBC27.05; Uncharacterized protein C27.05
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC27.05
Target Protein Sequence
MVHTTVYGLAYLFYSGINCILLYQLEIESKFYIRYQLIMRVQKETTDAFTLQLASKEVIT SSIYNTFNNTNEHMYLQPICNRIFLMTSIIDIASFKAQVLFLNIFMIK
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of SPBC27.05 in S. pombe?

SPBC27.05 is a gene locus in the fission yeast Schizosaccharomyces pombe that encodes an uncharacterized protein. The gene is located on chromosome 2 of S. pombe and has been annotated in genomic databases. Analysis of its genomic context reveals that it appears to be dubious (as labeled in genetic interaction studies) with limited functional characterization to date . S. pombe has been widely used as a model eukaryote to study a diverse range of biological processes, making it an important organism for understanding fundamental cellular mechanisms . Population genomic studies have revealed considerable variation in genomic regions across different S. pombe strains, which may affect the expression and function of genes like SPBC27.05 .

How does SPBC27.05 relate to characterized genes in the S. pombe genome?

Based on available data, SPBC27.05 appears among lists of genes studied in genetic interaction analyses, but with limited functional annotation . Unlike well-characterized genes such as cdc27+, which is required for the transition from G2 into mitosis and has a predicted 1116 nucleotide open reading frame with five introns , SPBC27.05 lacks extensive functional characterization. The genomic landscape of S. pombe has revealed that considerable amounts of noncoding DNA are under selective constraint, suggesting that even uncharacterized regions may have important biological functions . Researchers should consider potential relationships between SPBC27.05 and well-studied cell cycle regulation pathways since many previously uncharacterized genes have been found to participate in these networks.

What bioinformatic approaches can predict the function of SPBC27.05?

To predict the function of SPBC27.05, researchers should employ a multi-faceted bioinformatic strategy:

  • Sequence homology analysis: Compare the amino acid sequence with characterized proteins across species using tools like BLAST and HHpred

  • Domain prediction: Identify conserved functional domains using InterPro, Pfam, and SMART databases

  • Structural prediction: Generate 3D structural models using AlphaFold2 or similar tools to infer function

  • Gene expression correlation: Analyze co-expression patterns with genes of known function

  • Genetic interaction profiling: Examine synthetic genetic interactions as seen in the data where SPBC27.05 appears in interaction lists

Notably, genomic studies of S. pombe have revealed regions of high divergence between strains that may affect gene expression and function . This population-level variation should be considered when analyzing potential functions, as SPBC27.05 may have strain-specific behaviors or interactions.

What experimental designs are most suitable for studying SPBC27.05 function?

When investigating the function of the uncharacterized protein SPBC27.05, researchers should consider the following experimental designs:

  • Independent measures design: This approach allows comparison between wild-type and SPBC27.05 mutant strains, with different participants (cell populations) in each condition . This design is particularly advantageous when measuring growth rates, stress responses, or other phenotypes where carryover effects might interfere with results.

  • Repeated measures design: For time-course experiments tracking SPBC27.05 expression or localization through the cell cycle, this design provides statistical power by using the same cell population across different time points.

  • Genetic interaction screening: Given that SPBC27.05 appears in genetic interaction data with a value of -4.2388 , systematic synthetic genetic array (SGA) analysis would be valuable to comprehensively map its interaction network.

  • Complementation studies: Similar to how the cdc27+ gene was isolated by complementation of a temperature-sensitive mutant , researchers could use complementation approaches to probe SPBC27.05 function.

For rigorous analysis, researchers should employ randomization techniques and appropriate controls to minimize experimental bias, particularly when phenotypic effects may be subtle for uncharacterized genes.

How can CRISPR-Cas9 technology be applied to study SPBC27.05?

CRISPR-Cas9 technology offers several powerful approaches for studying SPBC27.05:

  • Gene knockout: Complete deletion of SPBC27.05 to assess its essentiality and associated phenotypes

  • Endogenous tagging: Addition of fluorescent tags or epitope tags to enable visualization and biochemical purification

  • Base editing: Introduction of point mutations to identify critical residues for protein function

  • CRISPRi/CRISPRa: Transcriptional repression or activation to modulate expression levels

  • Scarless editing: Precise nucleotide changes to address specific hypotheses about protein domains

When designing CRISPR experiments for SPBC27.05, researchers should:

  • Carefully select guide RNAs to minimize off-target effects

  • Consider the chromatin state of the SPBC27.05 locus, as accessibility varies across the S. pombe genome due to heterochromatin patterns that affect mating-type switching and other processes

  • Include appropriate controls such as wild-type strains and strains with non-targeting gRNAs

  • Validate edits through sequencing and assess off-target effects using whole-genome sequencing

What protein interaction methods are most effective for studying SPBC27.05?

To investigate the protein interaction network of SPBC27.05, researchers should consider these methodological approaches:

MethodTechnical ApproachAdvantagesLimitations
Affinity Purification-Mass Spectrometry (AP-MS)Tag SPBC27.05 with epitope tags and purify complexesIdentifies stable protein complexes in native conditionsMay miss transient interactions
Yeast Two-Hybrid (Y2H)Test direct interactions using split reporter systemHigh-throughput capability, detects binary interactionsHigh false positive rate, artificial expression levels
Proximity Labeling (BioID/APEX)Fusion of SPBC27.05 with biotin ligaseCaptures transient and proximal interactionsRequires optimization of labeling conditions
Co-immunoprecipitation (Co-IP)Precipitation with antibodies against SPBC27.05 or tagged versionPreserves physiological interactionsRequires specific antibodies or tagged constructs
Genetic Interaction MappingSystematic double mutant analysisReveals functional relationshipsIndirect evidence of physical interactions

Given that SPBC27.05 appears in genetic interaction datasets with a significant interaction score (-4.2388) , using complementary approaches to validate these interactions would be valuable. Researchers should be aware that protein interactions in S. pombe may be influenced by cell cycle stage, as seen with other cycle-regulated proteins like those encoded by cdc27+ .

What expression systems are optimal for producing recombinant SPBC27.05?

For successful production of recombinant SPBC27.05 protein, researchers should consider the following expression systems:

  • Bacterial expression (E. coli):

    • Advantages: Rapid growth, high yield, cost-effective

    • Limitations: Potential misfolding of eukaryotic proteins, lack of post-translational modifications

    • Recommended strains: BL21(DE3), Rosetta for rare codon optimization

  • Yeast expression (S. cerevisiae or native S. pombe):

    • Advantages: Closer to native folding environment, some post-translational modifications

    • Limitations: Lower yield than bacterial systems

    • Consideration: Using S. pombe as expression host may preserve species-specific interactions

  • Insect cell expression (Baculovirus):

    • Advantages: Eukaryotic post-translational modifications, good for complex proteins

    • Limitations: More time-consuming, higher cost

  • Mammalian cell expression:

    • Advantages: Most complete post-translational modifications

    • Limitations: Highest cost, lowest yield, most complex

When designing expression constructs, researchers should consider codon optimization, fusion tags for purification (His, GST, MBP), and cleavage sites for tag removal. Expression trials should test multiple conditions including temperature, induction timing, and media composition to optimize yield and solubility. The optimal system may depend on whether SPBC27.05 contains specific domains requiring eukaryotic folding machinery or post-translational modifications.

What purification challenges are anticipated for recombinant SPBC27.05?

Purification of recombinant SPBC27.05 may present several challenges that researchers should anticipate:

  • Solubility issues: As an uncharacterized protein, SPBC27.05 may have hydrophobic regions leading to aggregation. Researchers should:

    • Test multiple solubilization buffers with varying pH, salt concentrations, and additives

    • Consider fusion partners known to enhance solubility (MBP, SUMO, thioredoxin)

    • Optimize expression conditions (lower temperature, reduced induction)

  • Structural integrity: Without known structural data, ensuring properly folded protein requires:

    • Circular dichroism spectroscopy to verify secondary structure

    • Limited proteolysis to identify stable domains

    • Thermal shift assays to assess stability under different buffer conditions

  • Protein-specific considerations:

    • If SPBC27.05 participates in protein complexes, as suggested by genetic interaction data , co-expression with binding partners may improve solubility

    • Given the involvement of some S. pombe proteins in DNA processes, checking for nucleic acid contamination is essential

    • For membrane-associated proteins, detergent screening may be necessary

  • Purification strategy:

    • Initial capture using affinity chromatography (His-tag, GST, etc.)

    • Intermediate purification using ion exchange chromatography

    • Final polishing with size exclusion chromatography

    • Verification of purity by SDS-PAGE and mass spectrometry

Researchers should monitor protein quality throughout purification using functional assays if available or biophysical characterization methods.

How can post-translational modifications of SPBC27.05 be analyzed?

Analysis of post-translational modifications (PTMs) of SPBC27.05 requires a strategic approach:

  • Identification of PTMs:

    • Mass spectrometry (MS)-based proteomics is the gold standard

    • Bottom-up proteomics: Protein digestion followed by peptide analysis using LC-MS/MS

    • Top-down proteomics: Analysis of intact protein to preserve PTM combinations

    • Middle-down approach: Analysis of larger peptide fragments

  • Specific PTM enrichment strategies:

    • Phosphorylation: Titanium dioxide, immobilized metal affinity chromatography

    • Ubiquitination: Antibodies against di-glycine remnants

    • Glycosylation: Lectin affinity chromatography, hydrazide chemistry

    • Acetylation: Anti-acetyllysine antibodies

  • Functional validation of PTMs:

    • Site-directed mutagenesis of modified residues (e.g., S/T/Y to A for phosphorylation)

    • Comparing wild-type and mutant protein function in vivo

    • Cell cycle-dependent analysis, particularly important in S. pombe where many proteins are regulated through the cell cycle

  • Temporal dynamics:

    • Synchronization of S. pombe cultures to study cell cycle-dependent modifications

    • Stable isotope labeling to track modification kinetics

Given that many S. pombe proteins show cell cycle-regulated activity without changes in transcript levels (as observed with cdc27+ ), post-translational regulation through modifications may be particularly relevant for SPBC27.05 function.

How do mutations in SPBC27.05 affect cellular phenotypes in S. pombe?

Investigating phenotypic effects of SPBC27.05 mutations requires a systematic approach:

  • Generation of mutant strains:

    • Complete gene deletion (if non-essential)

    • Temperature-sensitive mutants (similar to those used for cdc27+ )

    • Point mutations in predicted functional domains

    • Regulated expression systems (overexpression, depletion)

  • Phenotypic characterization:

    • Growth rate measurements under various conditions

    • Cell morphology analysis (length, width, septation)

    • Cell cycle progression using flow cytometry

    • Chromosomal stability and DNA damage response

    • Stress resistance (temperature, oxidative, osmotic)

  • High-throughput phenotypic analysis:

    • Chemical genetic profiling across drug libraries

    • Synthetic genetic array analysis to identify genetic interactions

    • Automated microscopy for morphological phenotypes

  • Molecular phenotypes:

    • Transcriptome analysis (RNA-seq) to identify affected pathways

    • Proteome changes using mass spectrometry

    • Metabolic alterations using metabolomics

The genetic interaction value of -4.2388 reported for SPBC27.05 suggests significant genetic interactions that may provide clues to its function. Researchers should design experiments to test whether SPBC27.05 mutations affect pathways involved in cell cycle regulation, given the importance of these processes in S. pombe biology .

What structural characterization approaches are suitable for SPBC27.05?

Structural characterization of SPBC27.05 requires a multi-technique approach:

Given that many S. pombe proteins lack structural characterization, determining the structure of SPBC27.05 would contribute significantly to understanding its function. Researchers should consider whether SPBC27.05 might function as part of a complex, similar to many cell cycle regulatory proteins in S. pombe .

How does SPBC27.05 potentially interact with known cell cycle regulators?

To investigate potential interactions between SPBC27.05 and cell cycle regulators in S. pombe:

  • Genetic interaction analysis:

    • Synthetic genetic array (SGA) screening with known cell cycle mutants

    • Dosage suppression/enhancement screens with cell cycle regulators

    • Epistasis analysis to position SPBC27.05 in cell cycle pathways

  • Physical interaction studies:

    • Co-immunoprecipitation with tagged cell cycle proteins

    • Proximity labeling in synchronized cell populations

    • Fluorescence microscopy to assess co-localization during cell cycle progression

  • Functional studies:

    • Cell cycle progression analysis in SPBC27.05 mutants

    • Checkpoint activation assessment

    • Synthetic physical interaction screening using anchored proteins

  • Regulatory relationship analysis:

    • Phosphorylation status throughout cell cycle

    • Ubiquitination and degradation kinetics

    • Transcriptional and translational regulation

Given that cell division cycle genes like cdc27+ in S. pombe are required for the G2-M transition and have genetic relationships with key regulators like cdc2+ , investigating potential connections between SPBC27.05 and these established pathways would be valuable. The genetic interaction score for SPBC27.05 (-4.2388) suggests it may have important functional relationships with other genes that could point to a role in cell cycle regulation or related processes.

What comparative genomics approaches can help understand SPBC27.05 conservation?

To investigate the evolutionary conservation and significance of SPBC27.05:

  • Ortholog identification across species:

    • Reciprocal BLAST searches across fungal genomes

    • Synteny analysis to identify conserved genomic contexts

    • Hidden Markov Model (HMM) profile searches for distant homologs

  • Conservation pattern analysis:

    • Multiple sequence alignment of identified orthologs

    • Calculation of conservation scores for individual residues

    • Identification of conserved motifs or domains

  • Evolutionary rate analysis:

    • dN/dS ratio calculation to detect selective pressure

    • Relative rate tests to identify accelerated or constrained evolution

    • Branch-site models to detect episodic selection

  • Population genomics approaches:

    • Analysis of polymorphism within S. pombe populations

    • Identification of selective sweeps or high diversity regions

    • Comparison with the pattern of polymorphisms observed across the S. pombe genome

S. pombe population genomic studies have revealed that intergenic regions, introns, and untranslated regions show lower levels of nucleotide diversity than synonymous sites, suggesting functional constraints on noncoding DNA . Analysis of SPBC27.05 in this context could provide insights into its evolutionary importance. Researchers should also consider whether SPBC27.05 falls within regions showing extreme levels of divergence between strains, as such regions have been identified in chromosome 3 of S. pombe .

What statistical approaches are appropriate for analyzing SPBC27.05 functional data?

For robust analysis of experimental data related to SPBC27.05:

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization and blinding procedures to reduce bias

    • Appropriate controls for each experimental condition

    • Consideration of between-groups versus within-subjects designs based on experimental questions

  • Statistical testing frameworks:

    • Parametric tests (t-tests, ANOVA) for normally distributed data

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normal distributions

    • Multiple testing correction (Bonferroni, False Discovery Rate) for omics datasets

  • Specialized analytical approaches:

    • RNA-seq differential expression analysis (DESeq2, edgeR)

    • Proteomics quantification (MaxQuant, Skyline)

    • Interaction network analysis (weighted correlation network analysis)

    • Bayesian approaches for integrating prior knowledge

  • Visualization strategies:

    • Principal component analysis for high-dimensional data

    • Heatmaps for clustering analysis

    • Network graphs for interaction data

    • Custom visualizations for specific experimental outcomes

When analyzing genetic interaction data, such as the -4.2388 score reported for SPBC27.05 , researchers should consider established thresholds for significance in S. pombe genetic interaction studies and compare the magnitude of interactions with those of known pathway components.

How can contradictory results in SPBC27.05 research be reconciled?

When faced with contradictory results regarding SPBC27.05 function:

  • Systematic troubleshooting:

    • Verify strain backgrounds and genotypes through sequencing

    • Confirm expression levels of tagged proteins

    • Assess experimental conditions (temperature, media, cell density)

    • Evaluate reagent quality and specificity

  • Methodological considerations:

    • Different experimental approaches may access different aspects of protein function

    • In vitro versus in vivo studies may yield different results

    • Consider sensitivity and specificity of different methods

  • Contextual factors:

    • Cell cycle stage-specific effects (synchronization methods matter)

    • Environmental conditions affecting protein function

    • Genetic background effects that may influence outcomes

  • Integration strategies:

    • Develop testable models that account for apparently contradictory results

    • Design critical experiments to distinguish between alternative hypotheses

    • Consider quantitative rather than qualitative differences

  • Reporting recommendations:

    • Transparent reporting of all experimental conditions

    • Publication of negative results alongside positive findings

    • Consideration of biological versus technical replicates

As observed in fission yeast research, genes like cdc27+ can have complex functions that aren't evident from transcriptional patterns alone , suggesting that SPBC27.05 function may similarly depend on multiple factors requiring diverse experimental approaches to fully characterize.

What emerging technologies could advance understanding of SPBC27.05?

Several cutting-edge technologies could significantly advance research on SPBC27.05:

  • Single-cell approaches:

    • Single-cell RNA-seq to detect cell-to-cell variability in expression

    • Single-cell proteomics to track protein abundance at individual cell level

    • Live-cell imaging with advanced microscopy techniques

  • Spatial biology techniques:

    • Super-resolution microscopy for precise subcellular localization

    • Proximity labeling with TurboID or APEX2 for spatial interactome mapping

    • Correlative light and electron microscopy for structural context

  • High-throughput functional genomics:

    • CRISPR interference/activation screens at genome scale

    • Base editors and prime editors for precise genomic modifications

    • Perturb-seq combining genetic perturbations with single-cell readouts

  • Structural biology advances:

    • Cryo-electron tomography for in situ structural studies

    • Integrative modeling combining diverse structural data

    • AlphaFold-Multimer for modeling protein complexes

  • Synthetic biology approaches:

    • Minimal synthetic genetic circuits incorporating SPBC27.05

    • Orthogonal expression systems to control SPBC27.05 function

    • Engineered protein scaffolds to probe interaction domains

These technologies could help address unanswered questions about SPBC27.05, particularly in the context of understanding its potential role in cell cycle regulation or other processes important in S. pombe biology .

What interdisciplinary collaborations would benefit SPBC27.05 research?

Advancing knowledge of SPBC27.05 would benefit from strategic interdisciplinary collaborations:

  • Structural biology and biochemistry:

    • Expertise in protein purification and characterization

    • Access to advanced structural determination facilities

    • Experience with challenging proteins

  • Systems biology and computational modeling:

    • Network analysis expertise to position SPBC27.05 in cellular pathways

    • Machine learning approaches for function prediction

    • Modeling of dynamic processes (e.g., cell cycle)

  • Evolutionary biology:

    • Comparative genomics across fungal species

    • Population genetics expertise to interpret variation patterns

    • Ancestral sequence reconstruction

  • Chemical biology:

    • Development of small molecule modulators of SPBC27.05

    • Chemical genetic screening approaches

    • Photocrosslinkers for capturing transient interactions

  • Advanced microscopy:

    • Super-resolution imaging of SPBC27.05 localization

    • Quantitative image analysis expertise

    • Dynamic tracking through cell cycle phases

Collaborations spanning these disciplines would enable comprehensive characterization of SPBC27.05, similar to the multifaceted approaches that have been used to understand other genes in S. pombe such as those involved in mating-type switching and cell cycle regulation .

How might SPBC27.05 research contribute to broader understanding of S. pombe biology?

Research on SPBC27.05 has potential to advance several aspects of S. pombe biology:

  • Genome annotation and curation:

    • Functional characterization of uncharacterized genes improves genome annotation

    • Addition of experimentally verified functions to database resources

    • Identification of novel protein domains or functional motifs

  • Evolutionary insights:

    • Understanding gene conservation across yeast species

    • Identification of species-specific adaptations

    • Contribution to understanding genome evolution in the context of S. pombe population genomics studies

  • Cell cycle regulation:

    • Potential discovery of novel components in cell cycle pathways

    • Further elucidation of G2-M transition mechanisms complementing existing knowledge about genes like cdc27+

    • Insights into coordination between cell cycle and other cellular processes

  • Model system development:

    • Enhanced genetic toolbox for S. pombe

    • Validation of new methodologies using uncharacterized proteins as test cases

    • Contribution to comparative analyses with other yeast models

  • Translational potential:

    • Identification of conserved functions relevant to human biology

    • Potential antifungal targets if SPBC27.05 proves essential

    • Insights into fundamental biological processes with medical relevance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.