Recombinant Schizosaccharomyces pombe Uncharacterized protein C29A4.17c (SPAC29A4.17c)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Uncharacterized protein C29A4.17c (SPAC29A4.17c) is a protein that is produced utilizing recombinant DNA technology in the fission yeast Schizosaccharomyces pombe. The term "uncharacterized protein" indicates that the protein's function has not been definitively determined through experimental validation .

Characteristics of Schizosaccharomyces pombe

Schizosaccharomyces pombe, commonly referred to as fission yeast, serves as a valuable eukaryotic model organism in molecular and cell biology studies . It is particularly useful for studying cell cycle regulation, DNA repair, and cellular responses to stress . Genetic studies in yeasts such as S. pombe enable in vivo analysis of gene functions required for the cell division cycle in eukaryotes .

Production and Availability

Recombinant forms of SPAC29A4.17c are produced for research purposes. These recombinant proteins are often expressed with an N-terminal His tag to facilitate purification . Creative BioMart offers spac29a4.17c proteins for life sciences research . All products are rigorously tested to meet demanding research needs .

Gene Expression Profiling

Schizosaccharomyces pombe is used as a model to study nitrosative stress response . In one study, differential display was used to identify the differentially expressed genes in the fission yeast under nitrosative stress conditions .

RNA Triphosphatase

S. pombe RNA triphosphatase is encoded by a separate gene, which was named PCT1 . PCT1 contains a 5′-proximal intron and encodes a 303 amino acid polypeptide with extensive structural similarity to the catalytic domains of Cet1p and CaCet1p .

14-3-3 Mutant

The homothallic fission yeast Schizosaccharomyces pombe undergoes sexual differentiation when starved, but sam mutants such as those carrying mutations in adenylate cyclase (cyr1) or protein kinase A (pka1) mate without starvation . sam3 is a dominant negative allele of rad24, encoding one of two 14-3-3 proteins .

Potential Therapeutic Applications

Research has identified a protein that could be used to treat or prevent Parkinson's disease . HYPE adenylylates αSyn and reduces phenotypes associated with αSyn aggregation in vitro, suggesting a possible mechanism by which cells cope with αSyn toxicity .

Cytochrome c Gene Structure

The cytochrome c gene of the fission yeast Schizosaccharomyces pombe has been cloned by using the Saccharomyces cerevisiae iso-1-cytochrome c gene as a molecular hybridization probe . The DNA sequence and the 5' termini of the mRNA transcripts of the gene have been determined .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance for dry ice shipping arrangements; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
SPAC29A4.17c; Uncharacterized protein C29A4.17c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC29A4.17c
Target Protein Sequence
MNCLLLGRGFLHRFHPFRPVLCEDSASAATTITSQFKLNYRQIFIGSSLGLAAGFALGKL GRLFIVACSAVFATIAYINSKGLIRINWPQLQQQVIGPTEQYTGFHFPSSGRFNTQSTFP TIRNWICTNPNFKLSFFSAMYVGFVSS
Uniprot No.

Target Background

Database Links
Protein Families
FUN14 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is SPAC29A4.17c and what research tools are available?

SPAC29A4.17c is an uncharacterized protein from Schizosaccharomyces pombe (strain 972 / ATCC 24843, fission yeast). The protein consists of 147 amino acids and is currently available as a recombinant full-length protein with a His-tag, expressed in E. coli . Research tools for studying this protein include polyclonal antibodies raised in rabbit that react specifically with S. pombe SPAC29A4.17c. These antibodies have been tested for applications including ELISA and Western Blotting for protein identification . The antibody product is available in liquid form, stored in a buffer containing 50% glycerol, 0.01M PBS at pH 7.4, with 0.03% Proclin 300 as a preservative .

For protein detection methods, the following protocol parameters are recommended:

ApplicationRecommended DilutionIncubationDetection Method
Western Blot1:500-1:2000Overnight at 4°CHRP-conjugated secondary antibody
ELISA1:1000-1:50001-2 hours at RTHRP/AP substrate

What basic experimental approaches should I use to begin characterizing SPAC29A4.17c?

As an uncharacterized protein, initial characterization should follow a systematic approach:

  • Expression analysis: Determine when and where the protein is expressed using RT-PCR, Northern blotting, or RNA-seq to analyze mRNA expression patterns under different conditions.

  • Subcellular localization: Use GFP or other fluorescent protein tagging approaches similar to those described for other S. pombe proteins to determine cellular localization . Create a C-terminal GFP fusion construct and integrate it into the genome to ensure expression at endogenous levels.

  • Deletion analysis: Generate a deletion strain and assess viability and phenotypic changes. Based on systematic deletion analysis approaches used for other S. pombe proteins, analyze cellular morphology, growth rate, stress responses, and cell cycle progression .

  • Basic biochemical characterization: Purify the recombinant protein and perform size exclusion chromatography, circular dichroism, and thermal stability assays to gather information about basic structural properties.

  • Post-translational modification analysis: Perform mass spectrometry to identify potential phosphorylation, ubiquitination, or other modifications that might provide functional clues.

How can I systematically determine the function of SPAC29A4.17c?

Determining the function of an uncharacterized protein requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Perform homology searches using BLAST, PSI-BLAST, and HHpred

    • Conduct structural prediction using AlphaFold2 or similar tools

    • Identify conserved domains and motifs

    • Perform phylogenetic analysis to identify orthologs in other species

  • Transcriptomic profiling:

    • Compare gene expression signatures of deletion mutants with known mutants to identify clustered expression patterns

    • As demonstrated in studies of other S. pombe proteins, expression signatures can cluster mutants with similar functions, providing functional hints

  • Synthetic genetic interactions:

    • Perform synthetic genetic array (SGA) analysis by crossing the deletion mutant with a library of viable deletion mutants

    • Identify genetic interactions that suggest pathway participation

  • Proteomic approaches:

    • Perform affinity purification followed by mass spectrometry (AP-MS) to identify interaction partners

    • Use proximity labeling approaches like BioID or APEX to identify proximal proteins

  • Phenotypic characterization under varied conditions:

    • Test sensitivity to various stressors (temperature, oxidative stress, DNA damage, etc.)

    • Examine cell morphology and nuclear DNA organization as performed for other S. pombe proteins

What approaches can I use to investigate potential involvement of SPAC29A4.17c in specific cellular pathways?

To investigate pathway involvement, consider the following methodological approaches:

  • Epistasis analysis:

    • Create double mutants with genes in suspected pathways

    • Determine if phenotypes are additive, synergistic, or suppressive

  • Response to pathway inhibitors:

    • Test sensitivity of deletion mutants to specific inhibitors of major cellular pathways

    • Compare responses to those of known pathway component mutants

  • Pathway-specific reporter assays:

    • Use reporters for major signaling pathways (stress response, cell cycle, etc.)

    • Monitor pathway activation in wild-type versus deletion backgrounds

  • Phosphoproteomic analysis:

    • Compare phosphorylation changes in deletion mutants versus wild-type

    • Identify affected signaling networks

  • Conditional expression systems:

    • Create strains with regulatable expression (e.g., nmt1 promoter variants)

    • Analyze consequences of protein depletion or overexpression

The systematic approach used for fission yeast protein kinases provides an excellent methodological framework applicable to SPAC29A4.17c characterization .

How should I design experiments to analyze phenotypes of SPAC29A4.17c deletion mutants?

Phenotypic analysis should be comprehensive and quantitative:

  • Growth analysis:

    • Measure growth rates in liquid culture under standard conditions

    • Perform serial dilution spot tests on various media types

    • Test temperature sensitivity (25°C, 30°C, 36°C)

  • Microscopic analysis:

    • Examine cell morphology (length, width, septation index)

    • Analyze nuclear morphology using DAPI staining (similar to analysis performed for SPCC70.05c mutants)

    • Check for defects in cell polarity, cell wall integrity, and cytokinesis

  • Cell cycle analysis:

    • Perform flow cytometry to analyze DNA content

    • Use cell cycle markers to determine progression rates

    • Synchronize cultures and monitor division timing

  • Stress response assessment:

    • Test sensitivity to osmotic stress (KCl, sorbitol)

    • Evaluate oxidative stress responses (H₂O₂, menadione)

    • Examine DNA damage sensitivity (UV, MMS, HU)

  • Specialized phenotypic tests:

    • Assess mating efficiency and sporulation

    • Test for specific organelle defects

    • Evaluate membrane trafficking

For documentation, use standardized scoring systems for phenotypic analysis similar to those employed in the systematic deletion analysis of fission yeast protein kinases :

ConditionWild-typeSPAC29A4.17c ΔPhenotype Score
Growth at 30°C+++
Growth at 36°C+++
Cell morphologyNormal
Nuclear morphologyNormal
SeptationNormal
Oxidative stress+++
Cell wall stress+++

How can I determine if SPAC29A4.17c is essential for viability?

To determine essentiality, follow these methodological steps:

  • Heterozygous diploid deletion:

    • Create a heterozygous diploid with one SPAC29A4.17c allele deleted

    • Induce sporulation and perform tetrad analysis

    • Analyze the viability pattern of spores (2:2 viable:non-viable pattern suggests essentiality)

  • Conditional expression system:

    • Replace the endogenous promoter with a regulatable promoter (e.g., nmt1)

    • Repress expression and assess viability

    • Monitor cellular phenotypes during protein depletion

  • Analog-sensitive mutants:

    • If SPAC29A4.17c has potential enzymatic activity, create analog-sensitive mutants

    • Use chemical genetics approaches to acutely inhibit protein function

  • Auxin-inducible degron system:

    • Tag the protein with an AID tag

    • Rapidly deplete the protein upon auxin addition

    • Monitor immediate consequences

Based on the methodological framework used in systematic deletion analysis of fission yeast proteins, essentiality can be rigorously established through multiple approaches .

What experimental approaches can I use to determine the subcellular localization of SPAC29A4.17c?

To determine subcellular localization, implement these methodological approaches:

  • Fluorescent protein tagging:

    • Create C-terminal GFP fusions at the endogenous locus

    • Similar to localization studies performed for other S. pombe proteins (SPCC70.05c-GFP, SPBC17F3.02-GFP, and SPBC32H8.10-GFP)

    • Verify functionality of the fusion protein

    • Image during various cell cycle stages and growth conditions

  • Immunofluorescence microscopy:

    • Use available antibodies for immunolocalization

    • Co-stain with markers for specific organelles

    • Perform in both fixed and live cells when possible

  • Subcellular fractionation:

    • Separate cellular components by differential centrifugation

    • Perform Western blotting to detect protein in different fractions

    • Compare with known markers for various compartments

  • Time-lapse imaging:

    • Monitor dynamic localization throughout the cell cycle

    • Assess responses to various stressors or treatments

  • Super-resolution microscopy:

    • Use techniques like STORM or PALM for high-resolution localization

    • Determine precise spatial organization

Example documentation of localization patterns should include:

ConditionNuclearCytoplasmicCortical/MembraneSeptumOther Structures
Log phase
Stationary
Stress conditions
Cell division

What methods should I use to identify protein interaction partners of SPAC29A4.17c?

To identify interaction partners, use these methodological approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged versions of SPAC29A4.17c (His-tag, TAP-tag, or FLAG-tag)

    • Purify under native conditions to maintain interactions

    • Identify co-purifying proteins by mass spectrometry

    • Use appropriate controls to filter out non-specific interactions

  • Yeast two-hybrid screening:

    • Use SPAC29A4.17c as bait against a S. pombe cDNA library

    • Validate positive interactions with secondary assays

    • Consider both N and C-terminal fusions to avoid interference with interactions

  • Proximity labeling:

    • Fuse SPAC29A4.17c with BioID or APEX2

    • Label proximal proteins in living cells

    • Identify labeled proteins by mass spectrometry

  • Co-immunoprecipitation:

    • Use antibodies against SPAC29A4.17c for pulldown experiments

    • Verify interactions with suspected partners

    • Test interactions under different conditions

  • In vitro binding assays:

    • Express and purify recombinant SPAC29A4.17c

    • Perform pulldown assays with candidate interactors

    • Use techniques like Surface Plasmon Resonance to quantify interactions

Interaction data should be presented in networks and validated using multiple methods:

Interaction PartnerMethod of DetectionInteraction StrengthCondition SpecificityValidation Method
Protein XAP-MSHigh confidenceConstitutiveCo-IP
Protein YY2HMedium confidenceStress-inducedIn vitro binding

How can I use transcriptomic analysis to gain insights into SPAC29A4.17c function?

Transcriptomic analysis can provide functional insights through these methodological approaches:

  • Differential expression analysis:

    • Compare gene expression profiles between wild-type and SPAC29A4.17c deletion mutants

    • Identify significantly up- or down-regulated genes

    • Perform Gene Ontology enrichment analysis on affected genes

  • Expression signature comparison:

    • Compare expression signatures with those of known mutants

    • Use clustering approaches to identify functional relationships

    • This approach has successfully grouped functionally related kinase mutants in S. pombe (e.g., stress response mutants Δsty1, Δwis4, and Δwin1)

  • Condition-specific transcriptomics:

    • Analyze expression changes under various stressors or growth conditions

    • Identify condition-specific regulatory roles

    • Compare responses to those of known regulatory mutants

  • Time-course analysis:

    • Monitor expression changes during cell cycle progression

    • Analyze meiotic gene expression changes

    • Identify temporal patterns suggesting regulatory functions

  • Single-cell RNA-seq:

    • Characterize cell-to-cell variability in gene expression

    • Identify potential heterogeneous responses

Based on methodologies used for other S. pombe proteins, expression signature clustering can reveal functional relationships between seemingly unrelated proteins .

How should I approach resolving contradictory experimental results when studying SPAC29A4.17c?

When facing contradictory results, implement this methodological framework:

  • Systematic validation:

    • Verify strain backgrounds and eliminate potential suppressors

    • Confirm genetic modifications by PCR and sequencing

    • Validate antibody specificity with appropriate controls

    • Create multiple independent isolates to ensure reproducibility, as recommended in systematic deletion studies

  • Condition-dependent effects:

    • Test multiple growth conditions and stressors

    • Assess whether contradictions are condition-specific

    • Consider media composition, temperature, and growth phase

  • Quantitative analysis:

    • Move beyond qualitative observations to quantitative measurements

    • Use statistical approaches to assess significance of differences

    • Ensure adequate sample sizes and appropriate controls

  • Orthogonal methods:

    • Confirm key findings with independent methodological approaches

    • Use both genetic and biochemical techniques

    • Implement complementary imaging and molecular methods

  • Consideration of indirect effects:

    • Evaluate whether observed phenotypes are direct or indirect

    • Implement acute depletion or inhibition strategies

    • Use time-resolved approaches to distinguish primary and secondary effects

A systematic approach to resolving contradictions follows similar principles to those used in comprehensive deletion analysis studies, which include validation with multiple isolates and multiple methodological approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.