Recombinant Schizosaccharomyces pombe Uncharacterized protein C2F3.07c (SPAC2F3.07c)

Shipped with Ice Packs
In Stock

Description

Introduction to Schizosaccharomyces pombe as a Model Organism

Schizosaccharomyces pombe, commonly known as fission yeast, has emerged as a powerful model organism for molecular and cellular biology research. This unicellular eukaryote shares many fundamental biological processes with higher eukaryotes, including humans, making it invaluable for studying conserved cellular mechanisms. S. pombe has been extensively utilized in research related to cell cycle regulation, protein secretion, and gene expression, offering advantages such as rapid growth, genetic tractability, and a well-annotated genome.

Within this context, the study of uncharacterized proteins like C2F3.07c (SPAC2F3.07c) becomes particularly relevant, as it may reveal new insights into fission yeast biology and potentially improve its utility as a protein production platform.

Physical and Biochemical Properties

Based on the available data, SPAC2F3.07c is a protein with the following key characteristics:

PropertyDescription
OrganismSchizosaccharomyces pombe
Length101 amino acids (full length)
UniProt IDO14090
Gene NameSPAC2F3.07c
SynonymsUncharacterized protein C2F3.07c
Molecular WeightApproximately 20.5 kDa (estimated based on similar proteins)

While detailed structural information (such as crystal structure, domain organization, or post-translational modifications) is not yet available for this protein, its sequence analysis may provide clues about potential structural motifs or functional domains.

Expression Systems

The recombinant SPAC2F3.07c protein is typically produced using Escherichia coli as the expression host. The specific production process involves the expression of the full-length protein (amino acids 1-101) fused to an N-terminal histidine (His) tag . This N-terminal His-tag facilitates the purification process and potentially enhances the protein's solubility and stability.

The choice of E. coli as an expression system offers several advantages, including:

  • Rapid growth and high cell density cultures

  • Well-established genetic manipulation techniques

  • Efficient protein expression capabilities

  • Cost-effectiveness for research-scale production

Purification and Quality Control

The recombinant SPAC2F3.07c protein undergoes a series of purification steps to ensure high purity and quality. The expressed protein is purified to greater than 90% purity as determined by SDS-PAGE analysis . The purification process likely involves immobilized metal affinity chromatography (IMAC), which capitalizes on the affinity of the His-tag for metal ions like nickel or cobalt.

The final product is typically provided as a lyophilized powder, which enhances its stability during storage and transportation. Quality control measures include:

  • SDS-PAGE analysis to confirm purity (>90%)

  • Protein concentration determination

  • Verification of size and integrity

Reconstitution Protocol

The lyophilized protein requires proper reconstitution before use in experiments. The recommended reconstitution procedure includes:

  1. Brief centrifugation of the vial prior to opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of 5-50% glycerol (final concentration) for long-term storage, with 50% being the default recommendation

Buffer Composition

The recombinant protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . This buffer composition is designed to maintain protein stability and prevent degradation during storage.

Functional Characterization

As an uncharacterized protein, SPAC2F3.07c presents a significant opportunity for functional characterization studies. Such research could employ various approaches including:

  • Gene knockout or silencing to observe phenotypic effects

  • Protein localization studies using fluorescent tags

  • Interaction studies to identify binding partners

  • Structural analysis to determine three-dimensional conformation

The availability of recombinant SPAC2F3.07c protein facilitates these investigations by providing purified material for in vitro assays and for raising antibodies for detection in cellular contexts.

Comparative Proteomics

The study of uncharacterized proteins like SPAC2F3.07c can significantly benefit from comparative proteomics approaches. Recent research has demonstrated the value of comparative proteome analysis in understanding protein secretion in S. pombe . Such studies have revealed complex changes in various cellular components, including chaperones, secretory transport machinery, and proteins controlling transcription and translation.

Similar approaches could potentially elucidate the function of SPAC2F3.07c by comparing proteomic profiles between wild-type and knockout strains, or by examining changes in protein expression under various conditions.

Protein Secretion Studies

Research on protein secretion in S. pombe has shown that high-level protein secretion causes global changes in protein expression levels and that precursor availability and membrane composition can limit protein secretion . The study of proteins like SPAC2F3.07c may contribute to understanding these limitations and potentially improving S. pombe as a host for recombinant protein production.

Relationship to Known Cellular Pathways

While SPAC2F3.07c remains uncharacterized, research on other S. pombe proteins provides context for understanding potential cellular pathways in which it might function. For instance, studies have characterized important signaling pathways in S. pombe involving proteins such as Tsc1/Tsc2 and Rhb1 GTPase .

The Tsc1/2 complex in S. pombe regulates gene expression in response to nitrogen availability, with deletion of either tsc1 or tsc2 affecting gene induction upon nitrogen starvation . These pathways involve protein modifications including farnesylation, which is essential for the proper function of certain GTPases like Rhb1.

While no direct connection between SPAC2F3.07c and these pathways has been established, understanding these cellular contexts provides a framework for investigating the potential roles of uncharacterized proteins in S. pombe.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPAC2F3.07c; Uncharacterized protein C2F3.07c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC2F3.07c
Target Protein Sequence
MLVRENNSNDRSIIEYVIKILLISGISRIIILILAMFESIRHIIFHNDTNPSDARKFQMA ICRLSSQKSRKLKNPIESSTTSHKKKGYVRKCYECLQIQVS
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.