Recombinant Schizosaccharomyces pombe Uncharacterized protein C36.11 (SPBC36.11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For multiple uses, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
SPBC36.11; Uncharacterized protein C36.11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC36.11
Target Protein Sequence
MSISNDSLASTVPGDELPSSYPVFSSDFSYIKPSHVLDVVTVTSTAGPEATDDPSYSGFY STVISTQNPEPTSASTPPSASASSLPNGAQKHNHTGVIAGPIVGVLGGLIVLVIIFYCLR HFKRKKFLAEQQEFERQFEEEKSRLAAVRKNTEQEKMGYRGGYQMHSTPWASSPRNSTIP QRSQSFYNDTRRSSDLGANAADFVTPPGNVANSDNIRILKRNSIATIGNYRSPSALEKRR SISYGAVQSVQGRPLAPIPGRRPLSISSDLYNDSNSGSHSNDDSDETKLKQSSTESSSEL LDEKDKFDKNSLNDPFVTIRKSSYEHEISEEHKKHSKKRSEHF
Uniprot No.

Target Background

Database Links
Subcellular Location
Golgi apparatus membrane; Single-pass membrane protein. Note=Localizes to the cell tip and the barrier septum.

Q&A

What are the fundamental approaches to characterize an uncharacterized protein like SPBC36.11?

Characterization of an uncharacterized S. pombe protein typically begins with sequence analysis, followed by gene deletion studies to determine essentiality, and protein localization experiments. For SPBC36.11, researchers should first conduct bioinformatic analyses to identify conserved domains and potential homologs in other organisms. This should be followed by gene disruption using PCR-based homologous recombination approaches similar to those used for git7 characterization . If the gene is essential, consider creating conditional alleles using temperature-sensitive degron systems. Protein localization can be determined using GFP-tagging strategies, as demonstrated with other S. pombe proteins like Pik1 . Expression analysis under various growth conditions should also be performed to provide clues about function.

How can I determine if SPBC36.11 is an essential gene in S. pombe?

To determine if SPBC36.11 is essential, implement a gene deletion strategy using homologous recombination in a diploid strain. A PCR-based approach can be used to replace the gene with a selectable marker such as kanMX6, as was done with git7 . Specifically:

  • Design primers with 50-100 bp homology to the regions flanking SPBC36.11

  • Amplify a cassette containing a selectable marker (e.g., kanMX6)

  • Transform a diploid S. pombe strain with this cassette

  • Confirm integration by Southern blot or PCR analysis

  • Induce sporulation and analyze tetrad dissection results

If no viable haploid deletion mutants are recovered, this strongly suggests essentiality. Confirmation can be achieved by introducing a wild-type copy of the gene on a plasmid before deletion, as demonstrated in the case of Skp1 characterization .

What expression systems are appropriate for recombinant production of SPBC36.11?

For recombinant expression of SPBC36.11, several systems have been optimized for S. pombe proteins:

Expression SystemAdvantagesDisadvantagesRecommended Use
S. pombe nmt1 promoter series (pREP1, pREP41, pREP81)Native post-translational modifications, Variable expression levelsPotential toxicity when overexpressedInitial characterization, localization studies
S. cerevisiae expressionGood for complementation studiesMay lack S. pombe-specific modificationsFunctional conservation studies
E. coli pET systemsHigh protein yield, Easy purificationLacks eukaryotic modificationsStructural studies, antibody production
Baculovirus/insect cellsEukaryotic modificationsHigher cost, Complex setupComplex protein analyses requiring PTMs

When choosing an expression system, consider that the nmt1 promoter is thiamine-repressible, allowing controlled expression. For SPBC36.11, start with the pREP41 vector which provides moderate expression levels to avoid potential toxicity issues often observed with uncharacterized proteins .

What approaches should I use to identify potential protein interaction partners of SPBC36.11?

To identify interaction partners of SPBC36.11, implement a multi-faceted approach:

  • Yeast Two-Hybrid Screening: Use the SPBC36.11 coding sequence as bait against an S. pombe cDNA library. This technique successfully identified the interaction between Pik1 and Cdc4 .

  • Co-immunoprecipitation: Create epitope-tagged versions of SPBC36.11 (e.g., with HA or FLAG tags) and perform pull-down experiments followed by mass spectrometry.

  • Proximity-dependent biotin identification (BioID): Fuse SPBC36.11 with a biotin ligase to identify proximal proteins.

  • Genetic interaction screens: Construct synthetic genetic arrays to identify genes that show synthetic lethality or suppression when combined with SPBC36.11 mutations.

For validation of identified interactions, perform reciprocal co-immunoprecipitation experiments and ELISA assays as demonstrated with Pik1-Cdc4 interactions . Additionally, functional assays specific to the identified pathways should be developed to confirm biological relevance.

How can I create conditional alleles of SPBC36.11 for functional studies?

Creating conditional alleles is essential if SPBC36.11 proves to be an essential gene. Several approaches have been validated in S. pombe:

  • Temperature-sensitive degron system: Fuse SPBC36.11 to a temperature-sensitive dihydrofolate reductase (ts-DHFR) domain, allowing normal function at permissive temperature (25°C) and protein degradation at restrictive temperature (36°C) .

  • Auxin-inducible degron (AID) system: Tag SPBC36.11 with an AID tag, allowing rapid degradation upon addition of auxin to the growth medium.

  • Promoter replacement: Replace the native promoter with regulatable promoters like nmt1 (thiamine-repressible) or urg1 (uracil-inducible).

  • Site-directed mutagenesis: Identify conserved residues that might be essential for function (e.g., catalytic sites) and create point mutations. This approach was effective in studying Pik1 function by creating D709A (kinase-dead) and R838A (Cdc4-binding deficient) mutations .

Monitor the phenotypes upon conditional inactivation, focusing on cell morphology, division patterns, and septation as these are common defects observed in S. pombe mutants .

What methods are most effective for determining the subcellular localization of SPBC36.11?

For determining subcellular localization of SPBC36.11, consider these methodologies:

  • GFP-tagging: Create N- or C-terminal GFP fusions using vectors like pREP41-eGFP, which has been successfully used for other S. pombe proteins . Ensure the fusion doesn't disrupt protein function by complementation testing.

  • Immunofluorescence: Generate specific antibodies against SPBC36.11 or use epitope tags (HA, FLAG) for detection with commercial antibodies.

  • Subcellular fractionation: Separate cellular components biochemically and detect the protein by Western blotting.

  • Co-localization studies: Use established organelle markers to determine precise localization.

The choice between N- or C-terminal tagging should be informed by protein domain analysis to avoid disrupting functional domains. For dynamic localization studies during the cell cycle, time-lapse imaging of live cells expressing the GFP-tagged protein is recommended, as this approach revealed the medial localization of Pik1 during cytokinesis .

How can I determine if SPBC36.11 has enzymatic activity?

Determining enzymatic activity for an uncharacterized protein requires a systematic approach:

  • Bioinformatic analysis: Search for conserved catalytic domains that might suggest specific enzymatic functions.

  • In vitro activity assays: Express and purify recombinant SPBC36.11 and test for predicted activities based on domain analysis. If SPBC36.11 contains domains similar to kinases, phosphatases, or other enzymes, adapt established assays for these activities.

  • Substrate identification: If enzymatic activity is detected, identify physiological substrates through techniques like:

    • Protein arrays incubated with the recombinant enzyme

    • Mass spectrometry to identify post-translational modifications dependent on SPBC36.11

    • Targeted analysis of candidate substrates based on interaction studies

  • Mutational analysis: Create catalytic-dead versions by mutating predicted active site residues (similar to the D709A mutation in Pik1 ) and assess both in vitro activity and in vivo phenotypes.

For quantitative analysis of enzymatic parameters, establish conditions for linear reaction rates and determine Km and Vmax values for identified substrates.

What strategies can address contradictory phenotypic data when characterizing SPBC36.11 function?

When facing contradictory phenotypic data, implement these systematic approaches:

  • Genetic background analysis: Verify if differences in strain backgrounds contribute to phenotypic variations. Create multiple independent mutants in different genetic backgrounds.

  • Allele comparison: Different mutation types (null, hypomorphic, conditional) can produce varying phenotypes. Compare results from deletion mutants with point mutations affecting specific domains.

  • Redundancy assessment: Test for functional redundancy with related proteins through creation of double or triple mutants.

  • Conditional phenotype analysis: Examine phenotypes under different growth conditions (temperature, nutrients, stress), as some functions may only be revealed under specific conditions.

  • Quantitative phenotype measurement: Develop quantitative assays rather than relying on qualitative observations. For example, if studying septation defects, measure septum thickness, placement, and timing quantitatively .

  • Multiple methodological approaches: Confirm findings using independent techniques. For example, combine genetic, biochemical, and cell biological approaches to verify a proposed function.

Document and report all experimental conditions thoroughly to enable proper comparison with other studies.

How can I design structure-function studies for SPBC36.11 without crystal structure data?

Without crystal structure data, employ these alternatives for structure-function analysis:

  • Homology modeling: Identify homologs with known structures and generate prediction models using tools like AlphaFold2 or SWISS-MODEL.

  • Domain conservation analysis: Align SPBC36.11 with characterized homologs to identify conserved regions likely essential for function.

  • Systematic mutagenesis:

    • Alanine scanning of conserved residues

    • Creation of chimeric proteins with homologs

    • Truncation analysis to identify functional domains

  • Cross-species complementation: Test if SPBC36.11 can complement deletion of homologs in S. cerevisiae or other model organisms, as was done with S. pombe pik1 in S. cerevisiae pik1-101 mutants .

  • Suppressor screens: Identify mutations in other genes that suppress SPBC36.11 mutant phenotypes to reveal functional networks.

For validation of structure predictions, integrate computational approaches with experimental data, such as testing if predicted interaction interfaces can be disrupted by targeted mutations (similar to the R838A mutation in Pik1 that disrupted Cdc4 binding ).

How should high-throughput data for SPBC36.11 be analyzed and integrated with existing knowledge?

For effective analysis of high-throughput data:

  • Multi-omics data integration: Combine transcriptomics, proteomics, and interaction data using tools specifically designed for yeast data analysis.

  • Network analysis: Place SPBC36.11 within the context of known protein-protein interaction networks in S. pombe, similar to analyses conducted for other proteins like Git7 .

  • Gene Ontology (GO) enrichment: Analyze functions, processes, and localizations enriched among interacting partners or co-expressed genes.

  • Cross-species comparison: Compare with data from homologs in other organisms, particularly S. cerevisiae.

  • Temporal dynamics analysis: For time-series data, analyze expression or localization changes throughout the cell cycle.

Data TypeRecommended Analysis ToolsIntegration Approach
TranscriptomicsDESeq2, PomBase Expression ViewerCorrelation with cell cycle phases
ProteomicsMaxQuant, SAINT for interaction dataProtein complex prediction
Genetic InteractionsS. pombe genetic interaction databasePathway and process enrichment
LocalizationCellProfiler for quantitative imagingCo-localization with known markers

When interpreting results, consider that uncharacterized proteins may have pleiotropic effects, and careful separation of direct versus indirect effects is essential for accurate functional characterization.

What statistical approaches are appropriate for analyzing genetic interaction data involving SPBC36.11?

For genetic interaction data analysis:

  • Quantitative Genetic Interaction Mapping:

    • Calculate genetic interaction scores (ε) as the difference between observed and expected double mutant phenotypes

    • Apply appropriate normalization methods to account for differences in single mutant fitness

  • Statistical significance testing:

    • Use t-tests for pairwise comparisons

    • Apply FDR correction for multiple testing (Benjamini-Hochberg method)

    • Consider ANOVA for complex genetic interaction datasets

  • Network-based analysis:

    • Calculate correlation profiles between genetic interaction patterns

    • Apply hierarchical clustering to identify genes with similar interaction profiles

    • Use dimensionality reduction techniques (PCA, t-SNE) to visualize interaction spaces

  • Bayesian approaches:

    • Incorporate prior knowledge about related pathways

    • Update confidence in functional relationships based on new data

When interpreting genetic interactions, distinguish between different types of relationships (suppression, synthetic lethality, epistasis) as they suggest different functional relationships. For example, suppression of SPBC36.11 phenotypes by mutations in another gene might indicate antagonistic functions, while synthetic lethality suggests redundant or parallel pathways .

What are the most common technical challenges when working with recombinant SPBC36.11 and how can they be addressed?

Common technical challenges and solutions include:

  • Poor expression of recombinant protein:

    • Optimize codon usage for the expression host

    • Test different expression temperatures (15-30°C)

    • Try different fusion tags (His, GST, MBP) that can enhance solubility

    • Consider using the pREP series with varying promoter strengths as demonstrated for other S. pombe proteins

  • Protein mislocalization when tagged:

    • Test both N- and C-terminal tags

    • Use smaller tags like HA or FLAG if GFP disrupts localization

    • Confirm functionality of tagged protein through complementation tests

  • Inconsistent phenotypes in deletion studies:

    • Verify correct integration by sequencing

    • Test multiple independent transformants

    • Control for suppressor mutations by backcrossing

  • Difficulty detecting protein-protein interactions:

    • Try multiple approaches (Y2H, co-IP, BioID)

    • Optimize buffer conditions for co-immunoprecipitation

    • Consider formaldehyde cross-linking to stabilize transient interactions

  • Non-specific antibody reactivity:

    • Generate multiple antibodies against different epitopes

    • Validate specificity using deletion strains as negative controls

    • Use preimmune serum controls and blocking with recombinant protein

For all troubleshooting approaches, implement systematic parameter optimization and maintain detailed records of experimental conditions to identify key variables affecting outcomes.

How can I distinguish between direct and indirect effects in functional studies of SPBC36.11?

To distinguish between direct and indirect effects:

  • Acute vs. chronic inactivation:

    • Use rapid protein degradation systems (e.g., auxin-inducible degron) to observe immediate effects

    • Compare with long-term depletion phenotypes to identify secondary adaptations

  • Structure-guided mutations:

    • Create separation-of-function mutations that disrupt specific activities

    • Compare phenotypes of different mutations affecting distinct functions, as demonstrated with D709A and R838A mutations in Pik1

  • In vitro reconstitution:

    • Purify components and test direct biochemical activities

    • Gradually increase system complexity to identify minimally required components

  • Temporal analysis:

    • Perform time-course experiments after protein inactivation

    • Primary effects typically occur more rapidly than secondary consequences

  • Genetic bypass experiments:

    • Test if overexpression of downstream factors can rescue SPBC36.11 mutant phenotypes

    • Determine if constitutive activation of a proposed pathway bypasses the need for SPBC36.11

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.