Recombinant Schizosaccharomyces pombe Uncharacterized protein C3D6.13c (SPBC3D6.13c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPBC3D6.13c; Uncharacterized protein C3D6.13c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-726
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC3D6.13c
Target Protein Sequence
MRSNTFGSVMRISWVVAFITMVQTLVSGVPLTDNDLESEVSKGTWFIKYYLPSCGACKRL GPMWDNMVEKAKEQVEGSNFHFGEVDCSKELSSCANIRAVPTLYLYQNGEIVEEVPFGAS TSEASLLDFVETHLNPDTDPDIPSDEDVLTDEDTEEVASIQPALSTSVSSLSLASTAMSK SASASEFSGSSVTKASKKLTSSPTSVASKKATLSSVSKVASTSSLPVTSVSASVDPKSAA SKVQDAEFSIQTAPSFPKEKEEKENTEETEESKKSINPTGTSKALALDADIDAALTDKEG WFIQFYSSECDDCDDVSTAWYAMANRMRGKLNVAHINCAVSKRACKQYSIQYFPTFLFFK EEAFVEYVGLPNEGDLVSFAEEAANFEIREVELLDTVNAEKNGDVFFLYFYDDDSAEYLN IIRKTGIQLLGHANLYLTTSQQIAKKYRVVSFPKLIVVRDGIASYYPAKMAQDNKDYRRI LGWMKNNWLPVLPELRTSNSKEIFNDESVVLFLLNPELDDFDETKRTAQKIATEFLDEEG RTYQSNWQKETDKKNSLVNEAEEKNDLEAIEAAKNFHVNGKPSPTRFAWVNGKFWAQWLR KFDIDIEATGPRVIVYNAAQDIYWDETAKGTPISIEKDTVFDIIKQVETDPDHLKFKILK KNLGVEYLESYGLNIRVLYMVLGIVTVGILVWYFSGRRARTLQRRRHSTPILPVSMRSTG NSGKFD
Uniprot No.

Target Background

Gene References Into Functions
  1. In S. pombe, PDI2 provides protection against nitrosative and nutritional stresses. Its expression is positively regulated by nitric oxide and nitrogen starvation in a Pap1-dependent manner. PMID: 20204527
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the basic characteristics of Uncharacterized protein C3D6.13c?

Uncharacterized protein C3D6.13c (UniProt AC: P87178, UniProt ID: YB1D_SCHPO) is a translation product of the SPBC3D6.13c gene in Schizosaccharomyces pombe strain 972 / ATCC 24843 (fission yeast) . The protein is currently classified as uncharacterized, meaning its precise biological function has not been fully elucidated. In the Protein Ontology (PRO) database, it is cataloged with the ID PR:P87178 and the short label "Spom972h-SPBC3D6.13c" .

To begin characterizing this protein, researchers typically start with sequence analysis tools to identify conserved domains, potential structural motifs, and homology to characterized proteins in other organisms. Basic biochemical assays such as SDS-PAGE and Western blotting can be used to confirm expression and determine approximate molecular weight.

What experimental approaches are most effective for initial characterization of uncharacterized S. pombe proteins?

Initial characterization of uncharacterized proteins like SPBC3D6.13c should follow a systematic approach:

  • Bioinformatic analysis:

    • Sequence alignments to identify conserved domains

    • Structural prediction using tools like AlphaFold

    • Phylogenetic analysis to identify orthologs in other species

  • Expression analysis:

    • RT-PCR and qPCR to determine expression patterns under different conditions

    • RNA-seq to identify co-expressed genes

    • Translational profiling to determine regulation at the translational level

  • Subcellular localization:

    • GFP-tagging followed by fluorescence microscopy

    • Subcellular fractionation followed by Western blotting

  • Preliminary functional analysis:

    • Gene knockout or knockdown using CRISPR-Cas9 or RNAi

    • Phenotypic analysis of mutant strains under various conditions

A systematic experimental design approach is crucial, requiring careful definition of variables, formulation of specific hypotheses, and appropriate control of extraneous variables .

How should researchers design experiments to study translational regulation of SPBC3D6.13c under stress conditions?

When designing experiments to study translational regulation of SPBC3D6.13c under stress conditions, researchers should follow these methodological steps:

  • Define your variables clearly:

    • Independent variable: Stress condition (e.g., heat, oxidative stress, DNA damage)

    • Dependent variable: Translational efficiency of SPBC3D6.13c mRNA

    • Control variables: Cell density, media composition, growth phase

  • Develop a specific, testable hypothesis based on previous observations of stress-responsive translational regulation in S. pombe .

  • Design experimental treatments:

    • Expose cells to different stressors (heat, H₂O₂, MMS) as done in previous studies

    • Include appropriate controls (untreated cells)

    • Consider time-course experiments to capture dynamics of response

  • Measurement approach:

    • Polysome profiling to measure association of SPBC3D6.13c mRNA with ribosomes

    • Ribosome profiling to identify ribosome occupancy at nucleotide resolution

    • Western blotting to confirm changes at protein level

  • Data analysis:

    • Calculate translational efficiency (TE) as the ratio of RPF (ribosome protected fragments) to mRNA abundance

    • Compare TE across conditions using appropriate statistical tests

    • Analyze potential regulatory elements in UTRs that might mediate translational control

Based on previous research on translational regulation in S. pombe, some mRNAs show consistent translational regulation under specific stress conditions, with patterns of up- or down-regulation that might provide insight into SPBC3D6.13c function .

How does SPBC3D6.13c expression compare to other stress-responsive genes in S. pombe?

Based on translational profiling studies of S. pombe under environmental stress, genes show distinct patterns of translational regulation. Analysis should focus on comparing translational profiles of SPBC3D6.13c with known stress-responsive genes.

The following table summarizes translational regulation patterns observed in S. pombe under various stress conditions:

Stress ConditionNumber of Translationally Regulated mRNAsNotable Regulated Gene Families
Oxidative Stress (H₂O₂)Approximately 30-40Dehydrogenases, transporters, transcription factors
Heat StressApproximately 40-50Ribosomal proteins, F0/F1-ATPase subunits, stress response proteins
DNA Damage (MMS)Very few (≈1)SPAC23H3.15c (unknown function)

For comparative analysis, researchers should:

  • Perform RNA-seq and Ribo-seq experiments in parallel

  • Calculate translational efficiency changes for all mRNAs

  • Compare SPBC3D6.13c with known stress-responsive mRNAs

  • Conduct cluster analysis to identify co-regulated genes

  • Perform promoter analysis to identify common regulatory elements

What approaches should be used to resolve contradictory experimental results regarding SPBC3D6.13c function?

When facing contradictory experimental results regarding SPBC3D6.13c function, researchers should implement a systematic troubleshooting approach:

  • Technical validation:

    • Verify reagent quality and specificity (antibodies, primers, constructs)

    • Confirm strain identity through genotyping

    • Reproduce experiments with alternative methodologies

  • Experimental design evaluation:

    • Review control selection and implementation

    • Assess whether extraneous variables were properly controlled

    • Evaluate statistical power and sample size adequacy

  • Contextual considerations:

    • Examine whether differences in growth conditions explain discrepancies

    • Consider strain background effects (genetic modifiers)

    • Assess whether post-translational modifications affect results

  • Multi-method validation:

    • Combine genetic approaches (knockout, overexpression) with biochemical methods

    • Apply orthogonal techniques (e.g., mass spectrometry to confirm protein interactions)

    • Use in vitro and in vivo approaches to validate findings

  • Collaborative verification:

    • Engage independent laboratories to reproduce key experiments

    • Implement standardized protocols across research groups

    • Pool data for meta-analysis when possible

Resolving contradictions often requires recognizing that proteins may have context-dependent functions that vary with cellular conditions, developmental stage, or experimental approach.

How can hyperpolarized 13C spectroscopic imaging techniques be adapted to study metabolic changes in S. pombe strains with SPBC3D6.13c mutations?

Adapting hyperpolarized 13C spectroscopic imaging techniques to study metabolic changes in S. pombe strains with SPBC3D6.13c mutations requires significant methodological modifications from mammalian applications:

  • Sample preparation adaptations:

    • Develop high-density yeast culture methods compatible with MRI systems

    • Optimize cell permeabilization for hyperpolarized substrate uptake

    • Design specialized coils for small-volume high-sensitivity detection

  • Pulse sequence optimization:

    • Adapt spectral-spatial (SpSp) pulses for yeast metabolite resonances

    • Implement fast-spin-echo (FSE) sequences with spiral acquisitions

    • Apply adiabatic inversion pulses without slice selection gradients to maximize signal acquisition from both even and odd echoes

  • Substrate selection:

    • [1-13C]pyruvate as primary substrate (as used in previous studies)

    • Consider alternative hyperpolarized substrates based on predicted metabolic pathways affected by SPBC3D6.13c

  • Experimental design:

    • Compare wild-type vs. SPBC3D6.13c mutant strains

    • Measure metabolic flux rates under normal and stress conditions

    • Correlate spectroscopic findings with growth, survival, and stress response parameters

  • Data analysis:

    • Apply compressed sensing reconstruction techniques for accelerated acquisition

    • Develop mathematical models specific to yeast metabolism

    • Compare metabolic profiles across genetic backgrounds and conditions

This approach would provide unprecedented real-time metabolic information, potentially revealing SPBC3D6.13c's role in cellular metabolism during stress responses.

What are the key considerations for designing CRISPR-Cas9 knockout experiments for SPBC3D6.13c?

Designing effective CRISPR-Cas9 knockout experiments for SPBC3D6.13c requires careful planning:

  • Guide RNA design:

    • Select target sites with minimal off-target potential

    • Consider coding sequence and regulatory regions

    • Design multiple gRNAs targeting different regions of the gene

    • Avoid sequences with secondary structure that may impede Cas9 binding

  • Experimental controls:

    • Include non-targeting gRNA controls

    • Generate complementation strains expressing wild-type SPBC3D6.13c from an ectopic locus

    • Create point mutants to distinguish between essential domains

  • Phenotypic assessment:

    • Define independent variables (growth conditions, stressors) and dependent variables (growth rate, morphology, stress response)

    • Develop specific, testable hypotheses about SPBC3D6.13c function

    • Plan for both between-subjects and within-subjects experimental designs as appropriate

  • Validation strategy:

    • Confirm knockout at DNA level (sequencing)

    • Verify absence of transcript (RT-PCR)

    • Confirm protein elimination (Western blot if antibodies available)

    • Assess potential compensatory mechanisms (transcriptomics/proteomics)

  • Potential challenges:

    • If SPBC3D6.13c is essential, plan for conditional knockout strategies

    • Consider gene redundancy that may mask phenotypes

    • Be prepared for phenotypic heterogeneity requiring single-cell analysis

Following these guidelines will ensure robust, reproducible results that contribute meaningfully to understanding SPBC3D6.13c function.

How should researchers analyze translational changes in SPBC3D6.13c in response to environmental stressors?

Analysis of translational changes in SPBC3D6.13c in response to environmental stressors requires sophisticated experimental approaches and data analysis:

  • Experimental setup:

    • Apply standardized stress conditions (heat, oxidative stress, DNA damage) as established in previous studies

    • Include time-course sampling to capture dynamics of response

    • Maintain consistent cell density and growth phase across experiments

  • Polysome profiling methodology:

    • Fractionate cell lysates on sucrose gradients

    • Collect and analyze RNA from different fractions (free mRNPs, monosomes, polysomes)

    • Quantify SPBC3D6.13c mRNA distribution across fractions using RT-qPCR

  • Ribosome profiling approach:

    • Generate and sequence ribosome-protected fragments (RPFs)

    • Analyze ribosome occupancy along SPBC3D6.13c mRNA

    • Calculate translation efficiency (TE) as the ratio of RPF to mRNA abundance

  • Data analysis workflow:

    • Normalize data appropriately to account for technical variation

    • Apply statistical methods suitable for time-series data

    • Compare translational profiles with previously identified patterns for stress-responsive genes

  • Contextual interpretation:

    • Determine whether SPBC3D6.13c follows patterns similar to other stress-responsive mRNAs

    • Analyze 5' and 3' UTRs for regulatory elements that might explain translational control

    • Consider the role of RNA-binding proteins and stress granules in regulation

The sum of total difference between translational profiles can be calculated to quantify the magnitude of translational regulation, with a threshold of 30 often used to identify strongly regulated mRNAs .

What strategies can be employed to characterize protein-protein interactions involving SPBC3D6.13c?

Characterizing protein-protein interactions (PPIs) involving SPBC3D6.13c requires a multi-faceted approach:

  • Affinity purification coupled to mass spectrometry (AP-MS):

    • Tag SPBC3D6.13c with an affinity tag (e.g., TAP, FLAG, HA)

    • Isolate protein complexes under native conditions

    • Identify interacting partners by mass spectrometry

    • Validate key interactions using reciprocal pulldowns

    • Consider SILAC or TMT labeling for quantitative assessment of dynamic interactions

  • Proximity-based labeling approaches:

    • Express SPBC3D6.13c fused to BioID or APEX2

    • Allow proximity-dependent biotinylation of neighboring proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • Distinguish between stable and transient interactions

  • Yeast two-hybrid (Y2H) screening:

    • Use SPBC3D6.13c as bait against an S. pombe cDNA library

    • Implement stringent screening conditions to minimize false positives

    • Validate potential interactions in vitro and in vivo

    • Consider membrane yeast two-hybrid for membrane-associated interactions

  • In vitro validation methods:

    • Express and purify recombinant SPBC3D6.13c

    • Perform pull-down assays with candidate interactors

    • Use surface plasmon resonance or isothermal titration calorimetry to determine binding kinetics

    • Employ structural biology approaches (X-ray crystallography, cryo-EM) for detailed interaction characterization

  • Functional validation:

    • Assess the impact of mutations at potential interaction interfaces

    • Create genetic double mutants to identify genetic interactions

    • Use proximity ligation assay (PLA) for in situ detection of interactions

    • Implement FRET or BiFC to visualize interactions in living cells

Successful characterization of PPIs will provide crucial insights into SPBC3D6.13c function and its role in cellular processes.

How can researchers integrate multi-omics data to elucidate the function of SPBC3D6.13c?

Integrating multi-omics data to elucidate SPBC3D6.13c function requires sophisticated computational approaches and experimental design:

  • Comprehensive data collection:

    • Genomics: Comparative genomics across fungi to identify conserved regions

    • Transcriptomics: RNA-seq under various conditions, focusing on co-expression patterns

    • Proteomics: Protein abundance, post-translational modifications, and interaction networks

    • Metabolomics: Metabolite profiles in wild-type vs. mutant strains

    • Phenomics: Systematic phenotypic profiling under diverse conditions

  • Data integration strategies:

    • Implement network analysis to identify functional modules

    • Apply machine learning algorithms to predict functions from multi-dimensional data

    • Use Bayesian approaches to integrate heterogeneous data types

    • Develop custom visualization tools for integrated data exploration

  • Validation approaches:

    • Test predictions from integrated analysis with targeted experiments

    • Implement CRISPR-based functional screens

    • Use chemical genetics to probe predicted pathways

    • Develop reporter systems to monitor predicted processes in vivo

  • Analysis workflow:

    • Start with differential expression/abundance analysis across conditions

    • Identify correlated changes across omics layers

    • Build predictive models incorporating multiple data types

    • Validate key predictions experimentally

  • Collaborative frameworks:

    • Establish data sharing protocols across research groups

    • Implement standardized experimental and computational pipelines

    • Develop common ontologies for functional annotation

    • Create accessible databases for integrated data storage and retrieval

This integrated approach maximizes the value of individual experiments and increases the likelihood of functionally characterizing previously uncharacterized proteins like SPBC3D6.13c.

What emerging technologies show promise for characterizing uncharacterized proteins like SPBC3D6.13c?

Several emerging technologies hold significant promise for characterizing uncharacterized proteins like SPBC3D6.13c:

  • AI-driven structural biology:

    • AlphaFold2 and RoseTTAFold for accurate protein structure prediction

    • Structure-based function prediction using deep learning

    • Molecular dynamics simulations to predict functional mechanisms

    • Virtual screening to identify potential small molecule interactors

  • Single-cell technologies:

    • Single-cell transcriptomics to capture cell-to-cell variability in expression

    • Single-cell proteomics to identify protein abundance heterogeneity

    • Spatial transcriptomics to map expression to subcellular locations

    • Live-cell imaging with genetically encoded sensors to monitor activity

  • CRISPR technologies beyond gene knockout:

    • CRISPRi for tunable gene repression

    • CRISPRa for targeted activation

    • Base editors for precise nucleotide substitutions

    • Prime editing for flexible gene editing without double-strand breaks

    • CRISPR screening with single-cell readouts for high-resolution functional genomics

  • Advanced imaging techniques:

    • Super-resolution microscopy for nanoscale localization

    • Label-free imaging using intrinsic contrast mechanisms

    • Correlative light and electron microscopy (CLEM) for structural context

    • Live-cell imaging with minimal phototoxicity

  • In situ techniques:

    • Proximity labeling for spatially resolved interactomes

    • MERFISH and seqFISH for subcellular transcript localization

    • In situ cryo-electron tomography for native structural studies

    • Emerging hyperpolarization techniques adapted for cellular imaging

Implementation of these technologies will accelerate functional characterization of uncharacterized proteins and reveal new dimensions of cellular biology.

How should researchers approach the validation of computational predictions about SPBC3D6.13c function?

Validating computational predictions about SPBC3D6.13c function requires a systematic approach combining bioinformatics and experimental methods:

  • Prioritize predictions based on:

    • Statistical confidence scores

    • Consensus across multiple prediction algorithms

    • Biological plausibility and consistency with known data

    • Experimental feasibility for validation

  • Design validation experiments considering:

    • Independent variables: Conditions predicted to affect protein function

    • Dependent variables: Measurable outcomes reflecting predicted function

    • Appropriate controls: Negative controls, positive controls, and specificity controls

    • Between-subjects or within-subjects design as appropriate to the question

  • Implement tiered validation strategy:

    • Tier 1: Low-cost, high-throughput phenotypic assays

    • Tier 2: Medium-resolution biochemical or genetic validation

    • Tier 3: High-resolution, mechanistic studies of confirmed predictions

  • Address prediction limitations:

    • Consider species-specific aspects not captured in predictions

    • Test predictions under various environmental conditions

    • Evaluate whether predictions account for protein modifications

    • Assess whether computational models consider protein dynamics

  • Integration with experimental data:

    • Use validation results to refine computational models

    • Implement iterative prediction-validation cycles

    • Develop quantitative metrics to assess prediction accuracy

    • Share validation data with computational biology community to improve future predictions

This structured approach will maximize the value of computational predictions while establishing experimentally validated functions for SPBC3D6.13c.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.