Recombinant Schizosaccharomyces pombe Uncharacterized protein C3H7.08c (SPBC3H7.08c) is a protein derived from the fission yeast Schizosaccharomyces pombe . The term "recombinant" indicates that the protein is produced using genetic engineering techniques, where the gene encoding SPBC3H7.08c is inserted into a host organism (e.g., E. coli or S. pombe) to facilitate its expression and production . SPBC3H7.08c is referred to as an uncharacterized protein, suggesting that its specific function within the cell is not yet fully understood .
The amino acid sequence for SPBC3H7.08c is available. For example, one sequence is: MSIMRSIMSNRLVRWSREYPELFITWCVMTYTFGVAGYMLGQRGLLVQHEDQVRIPSKNAHPWEDTKSSSGKSDESLDYSYKYYPRGDRSKEPRKAPSAIQYSTFPVKGVSEEVLERFSK . Another protein, with UniProt ID O94322 has the following sequence: MSLAWKNELLKLLKENVDSSGVIHPEYFQLATLPTGNEIYPRNRTVAIRGFVGTGWHKPRPDDVLATDLLVFSTDIASHKAAEIAEQQKNTFPSGPIPNAFEMCGWLPKTMQQIRISGQIWLYTPELADRNEFPADKLIQDHLINSNGRIPEEWSWEEERRRIWELHSPELRASFSTPPSYSKYQGDVKVSPLPSTLTGKEDPGVIEAWKTAWGRFSLVVCEANEVEFLNLTPPPGKRVLHNRDLNTKQWSSTRVNV .
Purity: Typically greater than 85% as determined by SDS-PAGE .
Tag Information: The tag type is determined during the production process .
Host System: Often produced in E. coli as an in vitro system .
Storage Conditions: Store at -20°C; for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing are not recommended. Aliquots should be stored at 4°C for up to one week .
ELISA: Can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) .
Western Blotting: Suitable for Western blotting and immunoblotting (WB/IB) applications .
Antibody Production: Can be used to generate antibodies for research purposes .
Schizosaccharomyces pombe is a frequently utilized eukaryotic model organism in genetics and molecular biology . It is valuable for studying fundamental cellular processes such as cell division, DNA repair, and gene expression . S. pombe is often used for expressing and purifying eukaryotic proteins, offering post-translational modifications that are critical for the structure and function of these proteins .
KEGG: spo:SPBC3H7.08c
STRING: 4896.SPBC3H7.08c.1
SPBC3H7.08c is a conserved fungal protein encoded by a protein-coding gene in Schizosaccharomyces pombe (fission yeast). The full-length protein consists of 120 amino acids and is currently annotated as a hypothetical protein (NP_595767.1) in the NCBI database. Despite being conserved across fungal species, its specific biochemical functions remain largely uncharacterized, presenting significant research opportunities .
The gene is cataloged with Entrez Gene ID 2541007 and represents one of many conserved proteins in S. pombe whose functions have yet to be fully elucidated. While classified as a hypothetical protein, its conservation suggests functional importance in fungal biology.
SPBC3H7.08c is classified based on standard S. pombe nomenclature, where:
"SP" refers to Schizosaccharomyces pombe
"BC3H7" indicates its chromosomal location
"08c" denotes its specific position and orientation within that region
The gene encoding SPBC3H7.08c has been fully sequenced as part of the S. pombe genome project, which was one of the early eukaryotic genomes to be completely sequenced, providing valuable insights into eukaryotic biology . The mRNA transcript is documented as NM_001021668.2, which translates to the protein product NP_595767.1.
For recombinant production of SPBC3H7.08c, E. coli expression systems have been successfully employed. The protein can be expressed with a histidine tag to facilitate purification. The full-length construct (amino acids 1-120) has been successfully produced as demonstrated by commercially available recombinant preparations .
When expressing SPBC3H7.08c, researchers should consider the following methodological approach:
Clone the full coding sequence into an appropriate expression vector (e.g., pET series for E. coli)
Transform into a suitable E. coli strain (e.g., BL21(DE3))
Induce expression under optimized conditions (temperature, IPTG concentration)
Purify using affinity chromatography (Ni-NTA for His-tagged proteins)
Verify protein identity using mass spectrometry and/or Western blotting
This approach allows for production of sufficient quantities of the protein for subsequent functional and structural studies.
When designing experiments to study uncharacterized proteins like SPBC3H7.08c, researchers should distinguish between study design and statistical analysis. A robust experimental design should be established before data collection begins and clearly communicated in any research manuscript .
The experimental design should include:
Clear hypothesis formulation based on predicted functions from sequence homology or structural predictions
Selection of appropriate control proteins (characterized proteins with similar properties)
Determination of dependent and independent variables
Sample size calculation based on expected effect sizes
Randomization and blinding procedures where applicable
Detailed protocols for data collection that minimize bias
The study design should be described at the beginning of the methods section, separate from the statistical analysis description, to ensure reproducibility and proper understanding of the experimental approach . This clear separation helps reviewers and readers understand both how the data was obtained and how it was analyzed.
Functional characterization of uncharacterized proteins like SPBC3H7.08c requires a multi-faceted approach:
Bioinformatic analysis:
Sequence homology searches against characterized proteins
Domain prediction and structural modeling
Phylogenetic analysis to identify evolutionary relationships
Genetic approaches:
Gene knockout/knockdown studies to observe phenotypic changes
Complementation assays with orthologs from related species
Synthetic genetic array analysis to identify genetic interactions
Biochemical characterization:
In vitro enzymatic assays based on predicted functions
Protein-protein interaction studies (Y2H, co-IP, BioID)
Subcellular localization using tagged constructs
Systems-level analysis:
Transcriptomic profiling in knockout vs. wild-type strains
Proteomic changes associated with protein absence/overexpression
Metabolomic analysis if metabolic functions are suspected
This comprehensive approach maximizes the chances of identifying the biological role of SPBC3H7.08c, particularly if individual approaches yield inconclusive results.
Given the extensive research on DNA replication and repair pathways in S. pombe, investigating SPBC3H7.08c's potential involvement requires sophisticated methodological approaches:
Analyze protein localization during cell cycle progression, particularly during S phase when DNA replication occurs
Test for co-localization with known replication fork components
Examine phenotypic responses to replication stress (e.g., hydroxyurea treatment) in wild-type versus SPBC3H7.08c knockout strains
Investigate potential physical interactions with established replication fork barrier (RFB) components like Rtf1 and Rtf2
Assess the impact of SPBC3H7.08c deletion on replication-dependent recombination (RDR) using established assays
If SPBC3H7.08c functions in replication fork protection or processing, researchers might observe altered responses to replication stress or changes in the efficiency of replication fork barrier activity in deletion mutants. The RTS1 replication fork barrier system in S. pombe provides an excellent experimental framework for investigating such functions .
To effectively characterize protein-protein interactions involving SPBC3H7.08c, researchers should employ complementary approaches:
Affinity purification coupled with mass spectrometry (AP-MS):
Express tagged SPBC3H7.08c in S. pombe
Purify protein complexes under native conditions
Identify interacting partners by mass spectrometry
Validate key interactions by reciprocal pulldowns
Proximity-based labeling approaches:
BioID or TurboID fusion proteins to identify proximal proteins
APEX2 for temporal resolution of interaction dynamics
These methods are particularly valuable for transient interactions
Yeast two-hybrid screening:
Use SPBC3H7.08c as bait against an S. pombe cDNA library
Perform directed Y2H assays with candidate interactors
Validate interactions using alternative methods
In vitro reconstitution:
Purify recombinant SPBC3H7.08c and candidate interactors
Perform pulldown assays, gel filtration, or surface plasmon resonance
Determine binding parameters (Kd, kon, koff) for significant interactions
These complementary approaches provide robust validation and overcome limitations of individual methods, such as false positives in Y2H or loss of transient interactions in AP-MS.
When analyzing high-throughput data for uncharacterized proteins like SPBC3H7.08c, researchers should implement:
Rigorous statistical frameworks appropriate to the data type:
Account for multiple hypothesis testing
Apply appropriate normalization methods
Calculate false discovery rates
Use biological replicates rather than technical replicates alone
Integrative data analysis approaches:
Combine multiple data types (e.g., transcriptomics, proteomics)
Apply network analysis to position the protein in functional networks
Use enrichment analyses to identify significantly affected pathways
Compare results across different experimental conditions
Validation strategies:
Confirm key findings with orthogonal techniques
Test predictions with targeted experiments
Apply machine learning to identify patterns not evident in single-dataset analyses
These approaches should be clearly described in the methods section of any publication, separate from the description of the experimental design that generated the data .
Advanced bioinformatic approaches can provide valuable insights into potential functions of SPBC3H7.08c:
Sequence-based analyses:
Position-specific scoring matrices for remote homology detection
Hidden Markov Models for domain prediction
Coevolution analysis to identify functionally linked residues
Conservation mapping to identify functionally important residues
Structural bioinformatics:
Ab initio or homology-based 3D structure prediction
Molecular docking with potential substrates or interactors
Molecular dynamics simulations to assess conformational flexibility
Structural comparison with characterized proteins
Systems-level predictions:
Gene neighborhood analysis across fungal species
Co-expression network analysis
Protein-protein interaction network inference
Metabolic context analysis
These computational approaches generate testable hypotheses about SPBC3H7.08c function that can guide experimental design and interpretation.
If SPBC3H7.08c is suspected to function in DNA replication, Polymerase-usage sequencing (Pu-seq) offers a powerful approach to investigate its role:
Establish strains with rNTP permissive mutations in DNA polymerases (Polε and Polδ) in both wild-type and SPBC3H7.08c deletion backgrounds
Generate these strains in a ribonucleotide excision repair deficient context to allow rNMPs to persist in DNA
Extract genomic DNA, perform strand-specific mapping of replication by each polymerase
Compare polymerase usage patterns between wild-type and SPBC3H7.08c mutant strains
Analyze specific regions of interest, such as replication fork barriers, origins, or termination zones
This technique provides genome-wide information on how each DNA polymerase contributes to replication and can reveal whether SPBC3H7.08c affects polymerase usage or switching . Changes in polymerase usage patterns in the SPBC3H7.08c mutant would suggest a role in replication fork dynamics.
To investigate evolutionary conservation of SPBC3H7.08c:
Perform comprehensive ortholog identification:
Use reciprocal BLAST searches across fungal genomes
Apply sensitive profile-based methods (PSI-BLAST, HMMER)
Consider synteny conservation to confirm orthologous relationships
Conduct comparative sequence analysis:
Multiple sequence alignment of identified orthologs
Calculation of conservation scores for each residue
Identification of absolutely conserved residues as candidates for functional importance
Detection of lineage-specific accelerated evolution
Analyze selective pressure:
Calculate dN/dS ratios to identify positions under purifying or positive selection
Map conservation onto predicted structural models
Compare conservation patterns with characterized protein families
Perform functional complementation studies:
Express orthologs from diverse species in S. pombe SPBC3H7.08c deletion strain
Assess rescue of any observable phenotypes
Identify functionally critical regions through domain swapping
This evolutionary perspective can provide crucial insights into functional constraints and adaptations that have shaped SPBC3H7.08c throughout fungal evolution.
The following table summarizes key research applications and corresponding methodologies for studying SPBC3H7.08c:
Based on available information and context, the most promising research directions include:
Comprehensive phenotypic characterization of deletion/conditional mutants across diverse growth conditions
High-resolution localization studies during normal growth and stress conditions
Proteomic identification of interaction partners under various cellular states
Investigation of potential roles in DNA metabolism, given the context of research on replication fork barriers in S. pombe
Structural determination to provide insights into potential biochemical functions
Comparative analysis with orthologs in pathogenic fungi to assess potential as an antifungal target
These approaches, particularly when integrated, offer the greatest potential to transition SPBC3H7.08c from an uncharacterized to a fully characterized protein with defined biological roles.
When designing follow-up studies:
Prioritize validation of initial findings through independent methodologies
Focus on mechanistic investigations that explain observed phenotypes
Design experiments with appropriate controls that distinguish between direct and indirect effects
Consider genetic interaction studies to position SPBC3H7.08c in known pathways
Apply proper experimental design principles, clearly separating study design from statistical analysis
Integrate computational predictions with targeted experimental testing
Use quantitative rather than qualitative approaches where possible