Recombinant Schizosaccharomyces pombe Uncharacterized protein C3H7.08c (SPBC3H7.08c)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Uncharacterized protein C3H7.08c (SPBC3H7.08c) is a protein derived from the fission yeast Schizosaccharomyces pombe . The term "recombinant" indicates that the protein is produced using genetic engineering techniques, where the gene encoding SPBC3H7.08c is inserted into a host organism (e.g., E. coli or S. pombe) to facilitate its expression and production . SPBC3H7.08c is referred to as an uncharacterized protein, suggesting that its specific function within the cell is not yet fully understood .

Basic Characteristics

CharacteristicDescription
OrganismSchizosaccharomyces pombe (Fission yeast)
Protein TypeUncharacterized protein; function not yet fully elucidated
Production MethodRecombinant expression in a host organism
Amino Acid Length120 AA
Molecular WeightVaries depending on post-translational modifications
NCBI Gene ID2541074 (for a related protein, putative pyridoxamine 5'-phosphate oxidase)
UniProt IDO74383 , O94322 (for a related protein, putative pyridoxamine 5'-phosphate oxidase)
Gene NameSPBC3H7.08c

Sequence Information

The amino acid sequence for SPBC3H7.08c is available. For example, one sequence is: MSIMRSIMSNRLVRWSREYPELFITWCVMTYTFGVAGYMLGQRGLLVQHEDQVRIPSKNAHPWEDTKSSSGKSDESLDYSYKYYPRGDRSKEPRKAPSAIQYSTFPVKGVSEEVLERFSK . Another protein, with UniProt ID O94322 has the following sequence: MSLAWKNELLKLLKENVDSSGVIHPEYFQLATLPTGNEIYPRNRTVAIRGFVGTGWHKPRPDDVLATDLLVFSTDIASHKAAEIAEQQKNTFPSGPIPNAFEMCGWLPKTMQQIRISGQIWLYTPELADRNEFPADKLIQDHLINSNGRIPEEWSWEEERRRIWELHSPELRASFSTPPSYSKYQGDVKVSPLPSTLTGKEDPGVIEAWKTAWGRFSLVVCEANEVEFLNLTPPPGKRVLHNRDLNTKQWSSTRVNV .

Production and Quality Control

  • Purity: Typically greater than 85% as determined by SDS-PAGE .

  • Expression Region: 1-120 Sequence Info: fµLl length protein

  • Tag Information: The tag type is determined during the production process .

  • Host System: Often produced in E. coli as an in vitro system .

  • Storage Buffer: Tris-based buffer with 50% glycerol .

  • Storage Conditions: Store at -20°C; for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing are not recommended. Aliquots should be stored at 4°C for up to one week .

Applications

  1. ELISA: Can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) .

  2. Western Blotting: Suitable for Western blotting and immunoblotting (WB/IB) applications .

  3. Antibody Production: Can be used to generate antibodies for research purposes .

Schizosaccharomyces pombe as a Model Organism

Schizosaccharomyces pombe is a frequently utilized eukaryotic model organism in genetics and molecular biology . It is valuable for studying fundamental cellular processes such as cell division, DNA repair, and gene expression . S. pombe is often used for expressing and purifying eukaryotic proteins, offering post-translational modifications that are critical for the structure and function of these proteins .

Experimental Procedures

  • Reconstitution & Storage Instructions

  • Western Blotting/Immunoblotting (WB/IB) Protocol

  • Immunohistochemistry (IHC) Protocol

  • Immunocytochemistry (ICC) Protocol

  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol

  • Blocking Peptide Competition Protocol (BPCP)

  • Immunoprecipitation (IP) Protocol

  • Antibody Array (AA) Protocol

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPBC3H7.08c; Uncharacterized protein C3H7.08c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC3H7.08c
Target Protein Sequence
MSIMRSIMSNRLVRWSREYPELFITWCVMTYTFGVAGYMLGQRGLLVQHEDQVRIPSKNA HPWEDTKSSSGKSDESLDYSYKYYPRGDRSKEPRKAPSAIQYSTFPVKGVSEEVLERFSK
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the basic properties of SPBC3H7.08c protein?

SPBC3H7.08c is a conserved fungal protein encoded by a protein-coding gene in Schizosaccharomyces pombe (fission yeast). The full-length protein consists of 120 amino acids and is currently annotated as a hypothetical protein (NP_595767.1) in the NCBI database. Despite being conserved across fungal species, its specific biochemical functions remain largely uncharacterized, presenting significant research opportunities .

The gene is cataloged with Entrez Gene ID 2541007 and represents one of many conserved proteins in S. pombe whose functions have yet to be fully elucidated. While classified as a hypothetical protein, its conservation suggests functional importance in fungal biology.

How is SPBC3H7.08c genetically classified and organized in the S. pombe genome?

SPBC3H7.08c is classified based on standard S. pombe nomenclature, where:

  • "SP" refers to Schizosaccharomyces pombe

  • "BC3H7" indicates its chromosomal location

  • "08c" denotes its specific position and orientation within that region

The gene encoding SPBC3H7.08c has been fully sequenced as part of the S. pombe genome project, which was one of the early eukaryotic genomes to be completely sequenced, providing valuable insights into eukaryotic biology . The mRNA transcript is documented as NM_001021668.2, which translates to the protein product NP_595767.1.

What expression systems are recommended for recombinant production of SPBC3H7.08c?

For recombinant production of SPBC3H7.08c, E. coli expression systems have been successfully employed. The protein can be expressed with a histidine tag to facilitate purification. The full-length construct (amino acids 1-120) has been successfully produced as demonstrated by commercially available recombinant preparations .

When expressing SPBC3H7.08c, researchers should consider the following methodological approach:

  • Clone the full coding sequence into an appropriate expression vector (e.g., pET series for E. coli)

  • Transform into a suitable E. coli strain (e.g., BL21(DE3))

  • Induce expression under optimized conditions (temperature, IPTG concentration)

  • Purify using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Verify protein identity using mass spectrometry and/or Western blotting

This approach allows for production of sufficient quantities of the protein for subsequent functional and structural studies.

What experimental design principles should be applied when studying uncharacterized proteins like SPBC3H7.08c?

When designing experiments to study uncharacterized proteins like SPBC3H7.08c, researchers should distinguish between study design and statistical analysis. A robust experimental design should be established before data collection begins and clearly communicated in any research manuscript .

The experimental design should include:

  • Clear hypothesis formulation based on predicted functions from sequence homology or structural predictions

  • Selection of appropriate control proteins (characterized proteins with similar properties)

  • Determination of dependent and independent variables

  • Sample size calculation based on expected effect sizes

  • Randomization and blinding procedures where applicable

  • Detailed protocols for data collection that minimize bias

The study design should be described at the beginning of the methods section, separate from the statistical analysis description, to ensure reproducibility and proper understanding of the experimental approach . This clear separation helps reviewers and readers understand both how the data was obtained and how it was analyzed.

How should researchers approach functional characterization of SPBC3H7.08c?

Functional characterization of uncharacterized proteins like SPBC3H7.08c requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Sequence homology searches against characterized proteins

    • Domain prediction and structural modeling

    • Phylogenetic analysis to identify evolutionary relationships

  • Genetic approaches:

    • Gene knockout/knockdown studies to observe phenotypic changes

    • Complementation assays with orthologs from related species

    • Synthetic genetic array analysis to identify genetic interactions

  • Biochemical characterization:

    • In vitro enzymatic assays based on predicted functions

    • Protein-protein interaction studies (Y2H, co-IP, BioID)

    • Subcellular localization using tagged constructs

  • Systems-level analysis:

    • Transcriptomic profiling in knockout vs. wild-type strains

    • Proteomic changes associated with protein absence/overexpression

    • Metabolomic analysis if metabolic functions are suspected

This comprehensive approach maximizes the chances of identifying the biological role of SPBC3H7.08c, particularly if individual approaches yield inconclusive results.

How can researchers investigate potential roles of SPBC3H7.08c in DNA replication and repair processes?

Given the extensive research on DNA replication and repair pathways in S. pombe, investigating SPBC3H7.08c's potential involvement requires sophisticated methodological approaches:

  • Analyze protein localization during cell cycle progression, particularly during S phase when DNA replication occurs

  • Test for co-localization with known replication fork components

  • Examine phenotypic responses to replication stress (e.g., hydroxyurea treatment) in wild-type versus SPBC3H7.08c knockout strains

  • Investigate potential physical interactions with established replication fork barrier (RFB) components like Rtf1 and Rtf2

  • Assess the impact of SPBC3H7.08c deletion on replication-dependent recombination (RDR) using established assays

If SPBC3H7.08c functions in replication fork protection or processing, researchers might observe altered responses to replication stress or changes in the efficiency of replication fork barrier activity in deletion mutants. The RTS1 replication fork barrier system in S. pombe provides an excellent experimental framework for investigating such functions .

What methods are most effective for analyzing protein-protein interactions involving uncharacterized proteins like SPBC3H7.08c?

To effectively characterize protein-protein interactions involving SPBC3H7.08c, researchers should employ complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged SPBC3H7.08c in S. pombe

    • Purify protein complexes under native conditions

    • Identify interacting partners by mass spectrometry

    • Validate key interactions by reciprocal pulldowns

  • Proximity-based labeling approaches:

    • BioID or TurboID fusion proteins to identify proximal proteins

    • APEX2 for temporal resolution of interaction dynamics

    • These methods are particularly valuable for transient interactions

  • Yeast two-hybrid screening:

    • Use SPBC3H7.08c as bait against an S. pombe cDNA library

    • Perform directed Y2H assays with candidate interactors

    • Validate interactions using alternative methods

  • In vitro reconstitution:

    • Purify recombinant SPBC3H7.08c and candidate interactors

    • Perform pulldown assays, gel filtration, or surface plasmon resonance

    • Determine binding parameters (Kd, kon, koff) for significant interactions

These complementary approaches provide robust validation and overcome limitations of individual methods, such as false positives in Y2H or loss of transient interactions in AP-MS.

How should researchers analyze and interpret high-throughput data when studying uncharacterized proteins?

When analyzing high-throughput data for uncharacterized proteins like SPBC3H7.08c, researchers should implement:

  • Rigorous statistical frameworks appropriate to the data type:

    • Account for multiple hypothesis testing

    • Apply appropriate normalization methods

    • Calculate false discovery rates

    • Use biological replicates rather than technical replicates alone

  • Integrative data analysis approaches:

    • Combine multiple data types (e.g., transcriptomics, proteomics)

    • Apply network analysis to position the protein in functional networks

    • Use enrichment analyses to identify significantly affected pathways

    • Compare results across different experimental conditions

  • Validation strategies:

    • Confirm key findings with orthogonal techniques

    • Test predictions with targeted experiments

    • Apply machine learning to identify patterns not evident in single-dataset analyses

These approaches should be clearly described in the methods section of any publication, separate from the description of the experimental design that generated the data .

What bioinformatic approaches can predict potential functions of SPBC3H7.08c?

Advanced bioinformatic approaches can provide valuable insights into potential functions of SPBC3H7.08c:

  • Sequence-based analyses:

    • Position-specific scoring matrices for remote homology detection

    • Hidden Markov Models for domain prediction

    • Coevolution analysis to identify functionally linked residues

    • Conservation mapping to identify functionally important residues

  • Structural bioinformatics:

    • Ab initio or homology-based 3D structure prediction

    • Molecular docking with potential substrates or interactors

    • Molecular dynamics simulations to assess conformational flexibility

    • Structural comparison with characterized proteins

  • Systems-level predictions:

    • Gene neighborhood analysis across fungal species

    • Co-expression network analysis

    • Protein-protein interaction network inference

    • Metabolic context analysis

These computational approaches generate testable hypotheses about SPBC3H7.08c function that can guide experimental design and interpretation.

How can researchers utilize Polymerase-usage sequencing (Pu-seq) to study potential roles of SPBC3H7.08c in DNA replication?

If SPBC3H7.08c is suspected to function in DNA replication, Polymerase-usage sequencing (Pu-seq) offers a powerful approach to investigate its role:

  • Establish strains with rNTP permissive mutations in DNA polymerases (Polε and Polδ) in both wild-type and SPBC3H7.08c deletion backgrounds

  • Generate these strains in a ribonucleotide excision repair deficient context to allow rNMPs to persist in DNA

  • Extract genomic DNA, perform strand-specific mapping of replication by each polymerase

  • Compare polymerase usage patterns between wild-type and SPBC3H7.08c mutant strains

  • Analyze specific regions of interest, such as replication fork barriers, origins, or termination zones

This technique provides genome-wide information on how each DNA polymerase contributes to replication and can reveal whether SPBC3H7.08c affects polymerase usage or switching . Changes in polymerase usage patterns in the SPBC3H7.08c mutant would suggest a role in replication fork dynamics.

What approaches are recommended for studying the evolutionary conservation of uncharacterized proteins like SPBC3H7.08c?

To investigate evolutionary conservation of SPBC3H7.08c:

  • Perform comprehensive ortholog identification:

    • Use reciprocal BLAST searches across fungal genomes

    • Apply sensitive profile-based methods (PSI-BLAST, HMMER)

    • Consider synteny conservation to confirm orthologous relationships

  • Conduct comparative sequence analysis:

    • Multiple sequence alignment of identified orthologs

    • Calculation of conservation scores for each residue

    • Identification of absolutely conserved residues as candidates for functional importance

    • Detection of lineage-specific accelerated evolution

  • Analyze selective pressure:

    • Calculate dN/dS ratios to identify positions under purifying or positive selection

    • Map conservation onto predicted structural models

    • Compare conservation patterns with characterized protein families

  • Perform functional complementation studies:

    • Express orthologs from diverse species in S. pombe SPBC3H7.08c deletion strain

    • Assess rescue of any observable phenotypes

    • Identify functionally critical regions through domain swapping

This evolutionary perspective can provide crucial insights into functional constraints and adaptations that have shaped SPBC3H7.08c throughout fungal evolution.

Research Applications Table

The following table summarizes key research applications and corresponding methodologies for studying SPBC3H7.08c:

Research ObjectiveMethodological ApproachExpected OutcomeTechnical Considerations
Expression & PurificationE. coli expression with His-tagPurified protein for biochemical studiesOptimize codon usage for E. coli; consider solubility tags
Protein LocalizationGFP/RFP tagging in S. pombeSubcellular distribution patternVerify tag doesn't disrupt function; use C- and N-terminal tags
Functional DisruptionCRISPR/Cas9 or homologous recombinationPhenotypic consequences of gene deletionCreate conditional alleles if essential; validate knockout
Interaction PartnersAP-MS, Y2H, BioIDNetwork of physical interactorsCompare interactome under different conditions
Structure DeterminationX-ray crystallography, Cryo-EM, NMR3D structural modelAssess protein stability and homogeneity
Evolutionary AnalysisComparative genomicsConservation pattern across speciesInclude diverse fungal lineages in analysis
Potential DNA Replication RolePu-seq, replication stress assaysImpact on replication dynamicsCompare with known replication factors

What are the most promising research directions for fully characterizing SPBC3H7.08c?

Based on available information and context, the most promising research directions include:

  • Comprehensive phenotypic characterization of deletion/conditional mutants across diverse growth conditions

  • High-resolution localization studies during normal growth and stress conditions

  • Proteomic identification of interaction partners under various cellular states

  • Investigation of potential roles in DNA metabolism, given the context of research on replication fork barriers in S. pombe

  • Structural determination to provide insights into potential biochemical functions

  • Comparative analysis with orthologs in pathogenic fungi to assess potential as an antifungal target

These approaches, particularly when integrated, offer the greatest potential to transition SPBC3H7.08c from an uncharacterized to a fully characterized protein with defined biological roles.

How should researchers design follow-up studies based on initial findings about SPBC3H7.08c?

When designing follow-up studies:

  • Prioritize validation of initial findings through independent methodologies

  • Focus on mechanistic investigations that explain observed phenotypes

  • Design experiments with appropriate controls that distinguish between direct and indirect effects

  • Consider genetic interaction studies to position SPBC3H7.08c in known pathways

  • Apply proper experimental design principles, clearly separating study design from statistical analysis

  • Integrate computational predictions with targeted experimental testing

  • Use quantitative rather than qualitative approaches where possible

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.