Recombinant Schizosaccharomyces pombe Uncharacterized protein C4D7.07c (SPAC4D7.07c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
SPAC4D7.07c; Uncharacterized protein C4D7.07c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC4D7.07c
Target Protein Sequence
MMSRKRQASSNDFFDMEQLLIANDALVHQNHSTPNHASDELSVNDPSPLSRGLQSDVNSN ISRNISNTFFKKSIFFFVYYCKQALEFISTVFSIIKFLLNRRKVSFLLSFLLLFSLFLLI PNDGRVNIKFFYKDFVDRIPFRFIPSNFNISFGKHLEQAKSLFKSKFGNSSSTYNERDSI MPLLKLQSNLTEAKTLLYQNPISPEDVLLHFWDRNLMSTYDLKIQDINDSVNPLLNTYLD FIEKDIYLVSHLPVSEKHPGNIPISLVNKSVQAICSFAEHYNLLRNPSYRGFLRINNGES IFNLLCIEDLHESVNLDILCLKDILRNIAQSSKEAMYIVKRHNSSQSFYGNRSTTNFSII NSGLYLKKDAAKNLLAKQFDATYSYYHKDLEESVHQKLNSNLEKRVEKYIKHSCSQRNVA DHPDFALKVVGAVVDYGWTFPKPKFSDILRDYWGKKANLPTALLDTSINSNWCNYEDTVQ VSVRLNRPMYVRHISLIFPIHGDDSYFPREIQMFGLINDINYQILSNMNNLVLLATIPVS LSSVFEVNYYYLPKFSDTPGLLEEAYFNTFVFRAFSKNESLTSQICLYHIGIHGKEINEE F
Uniprot No.

Target Background

Gene References Into Functions
  1. SPAC4D7.07C, also known as csi2+ (chromosome segregation impaired 2), is reported to regulate mitotic microtubule length. PMID: 25253718
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is known about the SPAC4D7.07c protein in Schizosaccharomyces pombe?

SPAC4D7.07c is an uncharacterized protein in the fission yeast Schizosaccharomyces pombe. While comprehensive characterization is still ongoing, it is part of the S. pombe proteome that has been systematically studied in various contexts. The protein is commercially available in recombinant form for research purposes, which facilitates its study in laboratory settings . Current research approaches typically involve comparative genomics and functional studies to determine its role in cellular processes. Unlike some better-characterized S. pombe proteins that have been implicated in specific pathways (such as DNA damage response or cell cycle regulation), SPAC4D7.07c's precise function remains to be fully elucidated through targeted research efforts.

What experimental systems are suitable for studying SPAC4D7.07c?

Several experimental systems are appropriate for investigating SPAC4D7.07c, with S. pombe being the primary model organism. For protein characterization studies, researchers should consider:

  • Gene deletion/knockout systems using CRISPR-Cas9 or traditional homologous recombination techniques in S. pombe

  • Protein tagging approaches (GFP, mVenus, etc.) for localization studies as demonstrated in S. pombe microfluidic experiments

  • Recombinant protein expression systems for biochemical characterization

  • Microfluidic devices similar to those described for S. pombe aging studies, which allow long-term observation of cellular phenotypes

These systems should be selected based on specific research questions. For example, fluorescent tagging would be appropriate for localization studies, while recombinant protein would be suitable for in vitro biochemical assays or antibody production. Microfluidic devices particularly allow for prolonged observation of single-cell lineages under controlled conditions, which could reveal phenotypes associated with SPAC4D7.07c mutations or overexpression.

How can I confirm successful expression of recombinant SPAC4D7.07c?

Confirmation of successful recombinant SPAC4D7.07c expression requires multiple complementary approaches:

  • Western blotting: Using antibodies against the protein itself or against epitope tags (His-tag, FLAG-tag) if incorporated into the recombinant construct.

  • Mass spectrometry: For protein identification and verification of post-translational modifications.

  • Activity assays: While specific enzymatic activity is unknown for SPAC4D7.07c, general protein folding and stability can be assessed through thermal shift assays.

  • Size exclusion chromatography: To verify protein oligomerization state and proper folding.

  • Circular dichroism: To analyze secondary structure elements.

When working with uncharacterized proteins, it's essential to implement multiple validation techniques rather than relying on a single method. Additionally, comparison with negative controls (e.g., mock transfections or transformations) helps confirm that the detected protein is indeed SPAC4D7.07c rather than an artifact or contaminant.

What potential roles might SPAC4D7.07c play in DNA damage response pathways?

While SPAC4D7.07c is not specifically listed among the known DNA damage response (DDR) genes in S. pombe from the available search results, its investigation in this context would follow methodological approaches similar to those used for identified DDR genes. Potential roles could be investigated by:

  • Sensitivity profiling: Exposing knockout or overexpression strains to DNA damaging agents such as hydroxyurea (HU), bleomycin (BLM), methyl methanesulfonate (MMS), camptothecin (CPT), thiabendazole (TBZ), and UV radiation - similar to the profiling performed for known DDR genes .

  • Flow cytometry analysis: Examining cell cycle progression patterns following DNA damage, looking for phenotypes similar to known patterns (1C, 2C, 4C, etc.) as observed with other DDR genes .

  • Genetic interaction studies: Conducting synthetic lethality screens with known DDR pathway components, similar to the synthetic lethality approach used with cdc37ts mutants .

The table below summarizes phenotypic patterns observed in known DDR genes that could serve as comparisons for SPAC4D7.07c characterization:

Phenotype PatternExample GenesDNA Damage AgentsPotential Pathway Association
1C arrestrad1+, srs2+HU, BLM, MMS, UVCheckpoint activation
2C arrestrhp55+, set1+HU, BLM, MMS, TBZRepair pathway
4C accumulationmlo3+HU, BLM, MMS, CPT, UVCell division regulation
S4C patternpab1+, spt20+HU, MMS, TBZ, UVCell cycle progression

This systematic approach would help position SPAC4D7.07c within the broader context of DNA damage response mechanisms if it indeed functions in this capacity.

How can I design experiments to determine if SPAC4D7.07c interacts with known chaperone networks in S. pombe?

Given the importance of chaperone networks in protein folding and function, investigating SPAC4D7.07c's potential interactions with chaperones like Cdc37 and Hsp90 would follow these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against SPAC4D7.07c or tagged versions to pull down potential interacting partners, followed by mass spectrometry or western blotting to identify chaperones.

  • Yeast two-hybrid assays: Constructing fusion proteins to test direct interactions with known chaperones.

  • Synthetic lethality screens: Similar to the approach used with cdc37ts mutants where genetic interactions with cdc7 were identified , creating double mutants of SPAC4D7.07c with various chaperone mutants.

  • Localization studies: Using fluorescently tagged proteins to assess co-localization with chaperones during various cellular stresses or cell cycle stages.

  • Protein stability assays: Measuring SPAC4D7.07c protein levels and half-life in wild-type versus chaperone-deficient backgrounds.

Research design should include appropriate controls and consider the temporal dynamics of such interactions, as chaperone-client relationships may be transient or condition-dependent. The cdc37ts synthetic lethality screen approach provides a particularly useful methodological framework, as it successfully identified Cdc7 protein kinase as a Cdc37 client , demonstrating how uncharacterized protein functions can be revealed through such systematic approaches.

What computational approaches can predict SPAC4D7.07c function based on structural analysis?

Predicting SPAC4D7.07c function through computational approaches involves several complementary methods:

  • Homology modeling: Generating 3D structure predictions using software like AlphaFold2 or RoseTTAFold, followed by comparison with structurally characterized proteins.

  • Motif analysis: Identifying conserved functional domains or motifs using tools like PROSITE, Pfam, or SMART.

  • Molecular dynamics simulations: Exploring potential ligand binding sites and conformational dynamics.

  • Cross-species network inference: Implementing methods similar to those described in the literature for gene regulatory network inference across species . This approach leverages co-expression patterns to identify functional relationships without requiring explicit orthology information.

  • Phylogenetic profiling: Examining the co-occurrence patterns of SPAC4D7.07c with other genes across multiple species to infer functional relationships.

For cross-species network inference specifically, the iterative approach combining co-inertia analysis, back-transformation, Hungarian matching, and majority voting could be particularly valuable. This method has been shown to successfully identify functional relationships by maximizing the co-structure between datasets from different species, even when they represent different experimental contexts and were produced on different platforms.

How can I design experiments to determine if SPAC4D7.07c is involved in cellular aging processes?

Recent research has demonstrated that S. pombe shows interesting aging patterns, with certain lineages displaying aging-free characteristics while others follow a "live fast, die fast" trade-off . To investigate SPAC4D7.07c's potential role in these processes:

  • Long-term microfluidic observation: Implement a Mother Machine-like device as described in the literature to track cell lineages with SPAC4D7.07c deletions or overexpression, monitoring:

    • Cell division rates

    • Probability of death over generations

    • Cell size trajectories

    • Protein aggregate formation and inheritance

  • Protein aggregation studies: Since protein aggregation has been associated with cellular aging, examine whether SPAC4D7.07c:

    • Co-localizes with Hsp104-associated protein aggregates

    • Affects aggregate formation or clearance when deleted or overexpressed

    • Changes in expression or localization with cellular age

  • Stress response experiments: Expose cells to various stressors and measure:

    • Survival rates of SPAC4D7.07c mutants versus wild-type

    • Recovery time after stress removal

    • Changes in protein aggregation patterns

The experimental design should include appropriate controls and statistical analysis to differentiate between normal biological variation and effects specific to SPAC4D7.07c manipulation. Time-lapse microscopy combined with the microfluidic approach would be particularly valuable for capturing the dynamics of aging processes, as demonstrated in the literature where over 1,500 fission yeast old-pole cell lineages were tracked for up to 80 generations .

What are the optimal conditions for expressing and purifying recombinant SPAC4D7.07c?

Optimal expression and purification of recombinant SPAC4D7.07c requires systematic optimization of multiple parameters:

  • Expression system selection:

    • Bacterial systems (E. coli): Consider BL21(DE3), Rosetta, or SHuffle strains for proteins with disulfide bonds

    • Yeast systems: S. cerevisiae or native S. pombe for proper eukaryotic post-translational modifications

    • Insect/mammalian systems: For complex eukaryotic proteins requiring extensive modification

  • Expression conditions optimization:

    • Temperature: Test range from 16°C to 37°C

    • Induction time: 3-24 hours

    • Inducer concentration: IPTG (0.1-1.0 mM) for bacterial systems or appropriate inducer for other systems

    • Media composition: Rich vs. minimal media, supplementation with trace elements

  • Purification strategy:

    • Affinity tags: His6, GST, or MBP tags for initial capture

    • Buffer optimization: Test various pH ranges (pH 6.0-8.0), salt concentrations (100-500 mM NaCl), and stabilizing additives

    • Additional purification steps: Ion exchange, size exclusion chromatography

    • Tag removal: TEV or PreScission protease cleavage if tag interferes with functional studies

  • Stability assessment:

    • Thermal shift assays to identify stabilizing buffer components

    • Dynamic light scattering to monitor aggregation

    • Limited proteolysis to identify stable domains

Initial small-scale expression tests should be performed before scaling up to production quantities. Additionally, storage conditions should be optimized (glycerol percentage, temperature, addition of protease inhibitors) to ensure long-term stability of the purified protein.

How can I design CRISPR-Cas9 knockout or knockin experiments for SPAC4D7.07c?

Designing effective CRISPR-Cas9 experiments for SPAC4D7.07c requires careful consideration of several factors:

  • Guide RNA (gRNA) design:

    • Select target sites with minimal off-target potential using algorithms such as CHOPCHOP or CRISPOR

    • Design at least 3-4 gRNAs targeting different regions of the gene

    • Consider the PAM requirements of the Cas9 variant being used

    • Target conserved functional domains if performing knockdown rather than complete knockout

  • Repair template design:

    • For knockouts: Design homology arms (500-1000 bp) flanking the target site

    • For knockins: Include the desired insertion (tag, reporter) flanked by homology arms

    • Consider codon optimization for S. pombe if introducing exogenous sequences

  • Delivery method:

    • Transform assembled CRISPR components as plasmids or RNP complexes

    • Consider transient vs. stable expression of Cas9

    • Optimize transformation protocol for S. pombe (e.g., lithium acetate method with appropriate modifications)

  • Screening strategy:

    • Design PCR primers spanning the modification site for initial screening

    • Sequence verification of modifications

    • Phenotypic screening if the modification causes a predictable phenotype

    • Western blotting or RT-qPCR to confirm protein or transcript reduction

  • Controls:

    • Include non-targeting gRNA controls

    • Create reversion mutants to confirm phenotype specificity

    • Test multiple independent clones to rule out off-target effects

For S. pombe specifically, consider the efficiency of homologous recombination in this organism when designing repair strategies, as it might affect the approach chosen for introducing precise modifications.

What approaches can I use to identify potential interaction partners of SPAC4D7.07c?

Identifying interaction partners of SPAC4D7.07c requires a multi-faceted approach combining in vivo and in vitro techniques:

  • Affinity purification-mass spectrometry (AP-MS):

    • Tag SPAC4D7.07c with epitope tags (FLAG, HA, etc.)

    • Perform pulldowns under different cellular conditions (normal growth, stress, cell cycle stages)

    • Use SILAC or TMT labeling for quantitative comparison

    • Include appropriate controls (untransfected cells, unrelated tagged proteins)

    • Implement stringent statistical analysis to filter out common contaminants

  • Proximity-based labeling:

    • Fuse SPAC4D7.07c with BioID or APEX2

    • Allow in vivo biotinylation of neighboring proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach captures both stable and transient interactions

  • Yeast two-hybrid screening:

    • Use SPAC4D7.07c as bait against a S. pombe cDNA library

    • Consider membrane-based variants if membrane association is suspected

    • Validate positive hits with secondary assays

  • Co-localization studies:

    • Create fluorescently tagged SPAC4D7.07c

    • Perform co-localization studies with known cellular markers

    • Implement live-cell imaging to capture dynamic interactions

  • Genetic interaction screens:

    • Similar to the synthetic lethality approach with cdc37ts mutants

    • Create double mutants with genes of interest

    • Screen for phenotypic enhancement or suppression

  • Cross-species network inference:

    • Implement algorithms that identify gene relationships based on co-expression patterns

    • This can identify functional relationships even without direct physical interaction

Data from these complementary approaches should be integrated to create a high-confidence interaction network, which can then guide hypothesis generation about SPAC4D7.07c function.

How can I analyze RNA-seq data to identify genes co-regulated with SPAC4D7.07c?

RNA-seq data analysis for identifying genes co-regulated with SPAC4D7.07c requires a systematic analytical approach:

  • Data preprocessing:

    • Quality control using FastQC

    • Adapter and low-quality read trimming with Trimmomatic or similar tools

    • Alignment to S. pombe genome using HISAT2, STAR, or similar aligners

    • Feature counting with tools like featureCounts or HTSeq

  • Differential expression analysis:

    • Compare wild-type vs. SPAC4D7.07c knockout/overexpression using DESeq2 or edgeR

    • Implement appropriate experimental design accounting for batch effects and other variables

    • Apply FDR correction for multiple testing

    • Use log2 fold change thresholds combined with adjusted p-values for significance determination

  • Co-expression network construction:

    • Calculate pairwise correlations between gene expression profiles across multiple conditions

    • Consider Pearson, Spearman, or biweight midcorrelation coefficients

    • Implement WGCNA (Weighted Gene Co-expression Network Analysis) to identify modules of co-expressed genes

    • Visualize the network using tools like Cytoscape

  • Cross-species comparison:

    • Apply methods similar to those described in the literature for cross-species common gene regulatory network inference

    • Implement co-inertia analysis to find common patterns across datasets from different species

    • Use Hungarian algorithm matching for gene affiliation across species

  • Functional enrichment analysis:

    • Perform GO term enrichment analysis on co-expressed gene clusters

    • Pathway analysis using KEGG or other databases

    • Motif enrichment in promoters of co-regulated genes

This analytical framework provides not only a list of co-regulated genes but also functional insights into the biological processes SPAC4D7.07c might be involved in. The cross-species approach is particularly valuable as it can leverage data from better-characterized model organisms to inform S. pombe studies.

How should I interpret phenotypic data from SPAC4D7.07c knockout experiments?

Interpreting phenotypic data from SPAC4D7.07c knockout experiments requires careful consideration of multiple factors:

  • Growth characteristics analysis:

    • Compare growth rates in different media compositions

    • Assess colony morphology and cell morphology

    • Analyze cell cycle progression using flow cytometry

    • Construct growth curves under different conditions (temperature, nutrient availability, stress)

  • Stress response evaluation:

    • Test sensitivity to DNA damaging agents (HU, BLM, MMS, CPT, TBZ, UV) following protocols similar to those used for known DNA damage response genes

    • Categorize phenotypes based on established patterns (1C, 2C, 4C, etc.) as observed with known genes

    • Compare with phenotypic patterns of well-characterized genes to infer pathway involvement

  • Cell division and mortality assessment:

    • Use microfluidic devices similar to the Mother Machine described in aging studies

    • Track cell lineages for multiple generations

    • Analyze division times and correlation with death rates

    • Examine protein aggregation patterns and inheritance

  • Statistical analysis framework:

    • Apply appropriate statistical tests based on data distribution

    • Use multiple comparison corrections when testing multiple conditions

    • Implement time-series analysis for temporal phenotypes

    • Consider biological replicates vs. technical replicates in experimental design

  • Control experiments:

    • Include isogenic wild-type strains as controls

    • Create complementation strains to verify phenotype specificity

    • Generate point mutants to distinguish between different functional domains

When interpreting results, it's crucial to distinguish between direct effects of SPAC4D7.07c deletion and secondary effects due to cellular compensation mechanisms. Additionally, phenotypic analysis should be integrated with other data types (transcriptomics, proteomics) for a more comprehensive understanding of SPAC4D7.07c function.

How can I integrate proteomics and transcriptomics data to understand SPAC4D7.07c function?

Integrating proteomics and transcriptomics data provides a more comprehensive understanding of SPAC4D7.07c function through the following methodological approach:

  • Data collection and normalization:

    • Ensure comparable experimental conditions for both data types

    • Apply appropriate normalization methods for each data type

    • Consider time-course experiments to capture dynamic changes

  • Correlation analysis:

    • Calculate correlation between mRNA and protein levels for all genes

    • Identify genes with discordant patterns (high transcript/low protein or vice versa)

    • Position SPAC4D7.07c within this correlation landscape

  • Pathway enrichment analysis:

    • Perform separate enrichment analyses for transcriptomics and proteomics data

    • Identify pathways consistently enriched in both datasets

    • Highlight pathways uniquely enriched in one dataset but not the other

  • Network integration:

    • Construct protein-protein interaction networks from proteomics data

    • Overlay transcriptional regulatory networks

    • Apply methods similar to those used in cross-species network inference , particularly:

      • Co-inertia analysis to find common patterns

      • Back-transformation techniques

      • Hungarian algorithm matching for optimal alignment between datasets

  • Post-translational modification analysis:

    • Examine phosphoproteomics or other PTM data if available

    • Link modifications to transcriptional changes

    • Identify potential regulatory mechanisms

  • Visualization strategies:

    • Create integrated heatmaps showing both transcript and protein changes

    • Network visualization with multi-omics layers

    • Principal component analysis of combined datasets

This integrated approach helps identify post-transcriptional regulation, protein stability issues, and regulatory feedback loops that might not be apparent from either dataset alone. The methodology leverages techniques from cross-species analysis that are equally applicable to cross-omics integration, maximizing the information extracted from complementary data types.

What emerging technologies might advance our understanding of SPAC4D7.07c?

Several cutting-edge technologies hold promise for deepening our understanding of SPAC4D7.07c:

  • CryoEM and AlphaFold2 integration:

    • Combining experimental cryoEM with AI-based structure prediction for more accurate protein structures

    • Revealing potential binding pockets and functional domains

  • Single-cell multi-omics:

    • Applying simultaneous RNA-seq and proteomics at the single-cell level

    • Capturing cell-to-cell variability in SPAC4D7.07c expression and function

    • Correlating with cell cycle stage or stress response state

  • Advanced microfluidics and live-cell imaging:

    • Building on established microfluidic techniques for S. pombe

    • Implementing real-time monitoring of protein interactions using FRET or BRET

    • Long-term tracking of protein dynamics across multiple generations

  • CRISPR-based functional genomics:

    • Implementing CRISPR activation/interference for fine-tuned gene expression control

    • Creating allelic series to distinguish between different functional domains

    • High-throughput genetic interaction mapping

  • Cross-species network inference with advanced algorithms:

    • Applying and refining methods described in the literature

    • Implementing machine learning approaches to identify subtle patterns in multi-species datasets

    • Integrating multiple data types (transcriptomics, proteomics, metabolomics) into unified models

These technologies should be applied in an integrative manner rather than in isolation. For example, structural information from cryoEM/AlphaFold2 could guide CRISPR-based mutagenesis experiments, while microfluidic systems could provide the platform for long-term observation of the resulting phenotypes at the single-cell level.

How might SPAC4D7.07c research contribute to our understanding of conserved cellular processes?

Research on SPAC4D7.07c has potential to advance our understanding of conserved cellular processes through several avenues:

  • Evolutionary conservation analysis:

    • Identifying orthologs across species using sensitive detection methods

    • Characterizing functional divergence or conservation

    • Using cross-species network inference methods to identify conserved functional modules even in the absence of sequence conservation

  • DNA damage response pathway contributions:

    • Building on established methodologies for characterizing DNA damage response genes in S. pombe

    • Mapping SPAC4D7.07c into known pathways based on phenotypic similarities

    • Extrapolating findings to mammalian systems for potential biomedical applications

  • Protein quality control mechanisms:

    • Investigating potential interactions with chaperone networks like Cdc37-Hsp90

    • Exploring roles in protein aggregate formation and inheritance

    • Connecting to aging processes and stress response mechanisms

  • Cellular aging and mortality insights:

    • Building on the "live fast, die fast" trade-off observed in S. pombe

    • Examining how SPAC4D7.07c affects protein aggregation dynamics

    • Investigating potential roles in determining cellular lifespan

  • Translational implications:

    • Identifying human orthologs or functionally equivalent proteins

    • Exploring relevance to human disease processes

    • Considering therapeutic targeting strategies if disease relevance is established

The value of studying uncharacterized proteins like SPAC4D7.07c lies in their potential to reveal novel aspects of fundamental cellular processes. By using S. pombe as a model system and applying cross-species comparative approaches, findings can be positioned within the broader context of eukaryotic cell biology, potentially uncovering conserved mechanisms with relevance to human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.