SPAC4H3.12c is a hypothetical protein encoded by the gene SPAC4H3.12c in S. pombe. It is annotated as an "uncharacterized protein" due to insufficient experimental data on its molecular function, subcellular localization, or interaction partners. Key attributes include:
Uniprot ID: Q10219
Gene Name: SPAC4H3.12c
Expression Region: 1–101 amino acids (partial sequence)
AA Sequence: MIVSNRNYSHKNFNVTNNNFQVSCFNPILLKIILFLNTIVCIFYVYKIALCNEYIRFLAK CFLYILRCMSTVSLLSSAHKMNCCNFYSNYNILLVSSLFFF.
This protein is commercially available as a recombinant version, typically produced in E. coli or yeast systems, with purity levels exceeding 85% (SDS-PAGE verified) .
In S. pombe, uncharacterized proteins often participate in stress adaptation. For example:
SPAC4H3.03c: A conserved bacterial-like protein involved in carbohydrate metabolism, though its role in S. pombe remains unclear .
CESR Genes: Core Environmental Stress Response genes (e.g., tps1, ntp1) regulate trehalose metabolism and NADPH production, critical for stress resistance .
SPAC4H3.12c is not explicitly linked to these pathways, but its recombinant availability suggests potential utility in studying stress-related mechanisms.
In stress-response studies, genes like SPAC4H3.03c show elevated expression under KCl treatment (7.15-fold induction) . While SPAC4H3.12c is not listed in these datasets, such studies highlight the broader importance of uncharacterized proteins in S. pombe stress biology.
The lack of functional data for SPAC4H3.12c underscores the need for targeted research. Key gaps include:
Subcellular Localization: No experimental evidence exists for its localization (e.g., nucleus, mitochondria).
Interaction Partners: Potential complexes with transcription factors (e.g., Atf1, Pcr1) or kinases (e.g., Sty1) remain unexplored .
Functional Assays: Knockout or overexpression studies are required to elucidate its role in viability, stress resistance, or metabolic pathways.
Schizosaccharomyces pombe, commonly known as fission yeast, is a unicellular eukaryotic organism that has become a powerful model system in molecular and cell biology research. S. pombe cells are rod-shaped, typically measuring 3-4 micrometers in diameter and 7-14 micrometers in length. The genome of S. pombe consists of approximately 14.1 million base pairs distributed across three chromosomes, containing an estimated 4,970 protein-coding genes and at least 450 non-coding RNAs .
S. pombe is particularly valuable for studying uncharacterized proteins because:
It maintains a relatively simple genome compared to higher eukaryotes while sharing significant conservation with human cellular processes
Over 70% of S. pombe protein-coding genes have identifiable human orthologs, with more than 1,500 associated with human diseases
Its genome contains fewer duplicated genes (only 5%) compared to budding yeast, simplifying functional analysis
The subcellular localization of nearly all S. pombe proteins has been documented using green fluorescent protein tagging
It serves as an excellent model for studying cell cycle regulation, DNA damage responses, and gene expression patterns
When studying an uncharacterized protein like SPAC4H3.12c, researchers can leverage several genomic resources:
PomBase: The primary model organism database for S. pombe that integrates genomic, proteomic, and functional data. PomBase catalogs extensive information on gene function, protein characteristics, and mutant phenotypes that can provide context for understanding SPAC4H3.12c .
Genome-wide expression datasets: Resources like those generated in global transcriptional response studies can be analyzed to determine if SPAC4H3.12c shows expression patterns similar to genes of known function, particularly under various stress conditions .
Ortholog analysis: Comparative genomic approaches can identify potential orthologs of SPAC4H3.12c in other organisms, which may have better characterized functions.
Intron analysis: With 43% of S. pombe genes containing introns across 4,739 genes, analyzing the intron structure of SPAC4H3.12c may provide insights into potential alternative splicing events and protein variants .
Given that cell wall integrity is a crucial aspect of S. pombe biology, designing experiments to investigate SPAC4H3.12c's potential role requires a methodical approach:
Gene knockout/disruption: Create a SPAC4H3.12c deletion strain and assess cell morphology, growth characteristics, and sensitivity to cell wall stressors (such as Calcofluor White, Congo Red, and β-glucanases).
Phenotypic analysis: Compare the phenotype of SPAC4H3.12c deletion mutants with known cell wall mutants, particularly looking for similarities to β(1,3)-glucanosyl-transferase mutants (gas1Δ, gas2Δ, gas4Δ, gas5Δ) .
Osmotic support testing: Culture the deletion strain in media containing osmotic stabilizers (e.g., sorbitol or mannitol). If SPAC4H3.12c is essential for cell wall integrity, osmotic support may rescue growth defects, similar to what has been observed with gas1Δ mutants .
Enzymatic activity assays: Test the cell wall composition of mutant strains, particularly focusing on β(1,3)-glucan content and cross-linking, which are essential for cell wall integrity in S. pombe .
Gene expression analysis: Compare the expression profile of your deletion strain with wild-type under normal and stress conditions to identify potential compensatory mechanisms or affected pathways.
When expressing recombinant SPAC4H3.12c for functional or structural studies, consider these methodological approaches:
Homologous expression in S. pombe:
Advantages: Proper folding and post-translational modifications are more likely to be preserved
Recommended vectors: pREP series (containing nmt1 promoter with various strengths) or pJK148 for chromosomal integration
Expression control: The nmt1 promoter is thiamine-repressible, allowing for regulated expression
Heterologous expression systems:
E. coli: Use codon-optimized constructs and fusion tags (MBP, SUMO, or GST) to improve solubility
Insect cells: Baculovirus expression systems may be suitable if post-translational modifications are critical
Mammalian cells: Consider if human-like glycosylation patterns are essential for function
Purification strategy:
Design constructs with appropriate affinity tags (His, FLAG, or Strep-tag II)
Include a protease cleavage site between the tag and protein for tag removal
Consider using S. pombe-specific cell lysis buffers that account for its robust cell wall
Expression verification:
Western blotting with antibodies against the fusion tag
Mass spectrometry for protein identification
Activity assays if functional characteristics can be predicted
Environmental stress response is a well-studied aspect of S. pombe biology. To determine if SPAC4H3.12c is stress-responsive:
Analyze existing transcriptomic datasets: Review global transcriptional response data, particularly focusing on whether SPAC4H3.12c shows expression patterns similar to known stress-responsive genes like those in the Core Environmental Stress Response (CESR) .
Design RT-qPCR experiments: Measure the expression levels of SPAC4H3.12c under various stress conditions:
Oxidative stress (H₂O₂)
Heat shock
Osmotic stress (sorbitol, NaCl)
Nutrient limitation
Cell wall stress (Calcofluor White, caspofungin)
Reporter gene assays: Fuse the SPAC4H3.12c promoter to a reporter gene (e.g., GFP or luciferase) to monitor expression changes in real-time under different conditions.
Northern blot analysis: For more precise quantification of transcript abundance and detection of alternative transcripts.
Dependency on stress response pathways: Test if expression changes are dependent on known stress response pathways by examining SPAC4H3.12c expression in key deletion mutants:
The following table summarizes potential experimental approaches based on known stress response gene categories in S. pombe:
| Stress Category | Example Genes | Experimental Approach | Relevant Controls |
|---|---|---|---|
| Heat shock | hsp16+, hsp9+ | Temperature shift (30°C to 39°C) | Western blot for Hsp proteins |
| Oxidative stress | cta1+, gst2+ | H₂O₂ treatment (0.5-1mM) | Catalase activity assay |
| Cell wall stress | eng1+, gas1+ | Calcofluor White, β-glucanase | Microscopy for morphology |
| Carbon limitation | fbp1+, eno102+ | Glucose depletion | Fbp1 enzyme activity |
| General stress | CESR genes | Multiple simultaneous stressors | sty1Δ or atf1Δ strains |
Identifying protein interaction partners is essential for understanding the function of uncharacterized proteins. For SPAC4H3.12c, consider these methodological approaches:
Affinity purification coupled with mass spectrometry (AP-MS):
Tag SPAC4H3.12c with an epitope tag (e.g., TAP, FLAG, or HA) at either N- or C-terminus
Express the tagged protein at endogenous levels using native promoter
Perform pull-down experiments under various cellular conditions
Identify interacting proteins by mass spectrometry
Validate key interactions with reciprocal tagging and co-immunoprecipitation
Yeast two-hybrid screening:
Use SPAC4H3.12c as bait against an S. pombe cDNA library
Consider both conventional and membrane-based Y2H systems depending on predicted topology
Validate positive interactions with complementary methods
Proximity-based labeling:
Fuse SPAC4H3.12c with BioID or APEX2 enzyme
Identify proximal proteins through biotinylation and streptavidin pull-down
Particularly useful for identifying weak or transient interactions
Co-localization studies:
Create fluorescently tagged versions of SPAC4H3.12c and candidate interactors
Perform live-cell imaging to assess spatial and temporal co-localization
Use FRET or BiFC for direct interaction assessment
Genetic interaction screening:
Cross SPAC4H3.12c deletion strain with genome-wide deletion library
Identify synthetic lethal, sick, or suppressor interactions
Particularly informative for placing SPAC4H3.12c in biological pathways
When faced with contradictory data about protein localization, a systematic troubleshooting approach is essential:
Validate tagging approaches:
Compare N-terminal versus C-terminal tags (one may disrupt localization signals)
Test different fluorescent proteins (size and properties may affect localization)
Verify functionality of tagged proteins through complementation tests
Use multiple independent tagging methods (immunofluorescence with antibodies)
Consider cell cycle dependence:
Assess environmental influences:
Cross-reference with proteomic datasets:
Genetic background effects:
Test localization in different strain backgrounds
Consider potential effects of auxotrophic markers or additional mutations
For difficult-to-characterize proteins like SPAC4H3.12c, innovative experimental designs that integrate multiple approaches are often necessary:
Optimized CRISPR-Cas9 for S. pombe:
Implement multiplexed CRISPR-Cas9 editing to create precise mutations
Design an allelic series ranging from point mutations to domain deletions
Create conditional alleles using auxin-inducible degrons or temperature-sensitive mutations
Apply techniques from experimental design optimization literature to maximize information gain
Functional genomics with saturation mutagenesis:
Perform deep mutational scanning of SPAC4H3.12c
Develop high-throughput phenotypic assays
Map mutational effects to protein structure predictions
Integrative multi-omics approach:
Combine transcriptomics, proteomics, and metabolomics data
Apply network analysis to place SPAC4H3.12c in biological context
Use machine learning to identify patterns across datasets
Design follow-up experiments based on computational predictions
Single-cell approaches:
Implement single-cell RNA-seq to detect cell-to-cell variation
Perform high-content imaging with machine learning analysis
Use microfluidics to study protein dynamics in response to perturbations
Synthetic biology approaches:
Reconstitute potential pathways in heterologous systems
Design synthetic genetic circuits to test hypothesized functions
Create chimeric proteins with domains from characterized orthologs
The table below compares different experimental design strategies for uncharacterized proteins:
| Approach | Information Yield | Technical Complexity | Resource Requirements | Time Investment |
|---|---|---|---|---|
| Traditional knockout | Medium | Low | Low | Medium |
| CRISPR allelic series | High | High | Medium | High |
| Multi-omics integration | Very High | Very High | High | High |
| Synthetic reconstitution | Medium-High | High | Medium | High |
| Evolutionary analysis | Medium | Low | Low | Medium |
Based on the importance of cell wall integrity in S. pombe and the critical role of β(1,3)-glucanosyl-transferases, investigating SPAC4H3.12c's potential involvement requires sophisticated approaches:
Comparative phenotypic analysis:
Create precise deletion and point mutations in SPAC4H3.12c
Compare phenotypes with those of gas1Δ, gas2Δ, and gas5Δ mutants under identical conditions
Test for osmotic remediation of growth defects, which is characteristic of cell wall integrity mutants
Examine sensitivity to specific cell wall stressors (β-glucanases, Calcofluor White, Congo Red)
Biochemical activity testing:
Express and purify recombinant SPAC4H3.12c
Test for β(1,3)-glucanosyl-transferase activity using established assays
Compare substrate specificity with known Gas proteins (substrate length preferences, cleavage point, product size)
Analyze cell wall composition in mutants using specific enzymatic digestions and chromatographic methods
Genetic interaction mapping:
Create double mutants with known cell wall genes (gas1+, gas2+, gas4+, gas5+)
Test for synthetic lethality, sickness, or suppression
Perform genome-wide genetic interaction screening to place SPAC4H3.12c in the cell wall integrity network
Protein localization and dynamics:
Determine if SPAC4H3.12c localizes to sites of cell wall synthesis (cell tips during interphase, division septum during cytokinesis)
Compare localization patterns with known Gas proteins
Examine co-localization with cell wall synthesis machinery
Transcriptional profiling:
Compare gene expression changes in SPAC4H3.12c mutants with those in gas mutants
Look for activation of compensatory pathways typical of cell wall integrity disruption
Analyze expression under conditions known to stress the cell wall
The table below summarizes key characteristics of β(1,3)-glucanosyl-transferases in S. pombe for comparison with SPAC4H3.12c:
| Protein | Essential for Viability | Substrate Specificity | Expression Pattern | Localization | Phenotype |
|---|---|---|---|---|---|
| Gas1p | Yes (requires osmotic support) | Prefers longer β(1,3)-glucan chains | Constitutive | Cell periphery | Severe cell lysis, morphology defects |
| Gas2p | No | Limited chain length specificity | Cell cycle regulated | Septum | Minor morphological defects |
| Gas5p | No | Intermediate specificity | Stress-responsive | Cell tips, septum | Mild cell wall weakness |
| SPAC4H3.12c | ? | ? | ? | ? | ? |
Given the extensive research on stress responses in S. pombe, sophisticated transcriptomic approaches can place SPAC4H3.12c in the context of global stress response networks:
Time-resolved RNA sequencing:
Design time-course experiments capturing early, intermediate, and late stress responses
Compare wild-type and SPAC4H3.12c deletion strains under multiple stress conditions
Identify genes with altered expression kinetics in the mutant
Analyze data using time-series clustering algorithms to identify co-regulated gene modules
Single-cell transcriptomics:
Apply scRNA-seq to capture cell-to-cell variation in stress responses
Identify potential heterogeneity masked in bulk RNA-seq experiments
Compare population-level responses between wild-type and SPAC4H3.12c mutants
Targeted transcription factor analysis:
Integration with stress signaling pathways:
Comparative transcriptomics across species:
Compare stress responses between S. pombe, S. cerevisiae, and other fungal species
Identify conserved versus species-specific responses involving SPAC4H3.12c orthologs
Use evolutionary conservation to prioritize functional hypotheses
The following table categorizes stress response genes in S. pombe based on previous studies and provides context for analyzing SPAC4H3.12c's potential involvement:
Modern computational approaches can provide valuable insights into the potential function of uncharacterized proteins:
AI-based structure prediction:
Apply AlphaFold2 or RoseTTAFold to predict SPAC4H3.12c structure
Compare predicted structure with known protein folds in the PDB
Identify potential catalytic sites or binding pockets
Use structure-based function prediction algorithms to generate hypotheses
Integrative domain analysis:
Identify conserved domains using HHpred, PFAM, and InterPro
Map conservation patterns onto structural models
Identify potential glycosylation, phosphorylation, or other post-translational modification sites
Compare with known cell wall proteins, particularly β(1,3)-glucanosyl-transferases
Molecular dynamics simulations:
Simulate protein behavior in different environments
Test potential substrate binding through virtual docking
Identify conformational changes that might be functionally relevant
Generate testable hypotheses about protein-protein interactions
Evolutionary analysis:
Perform phylogenetic analysis across fungal species
Identify patterns of co-evolution with other proteins
Map conserved versus variable regions to infer functional constraints
Apply ancestral sequence reconstruction to understand evolutionary trajectories
Network-based function prediction:
Integrate protein-protein interaction data
Apply gene neighborhood analysis across species
Use protein co-expression patterns to predict function
Identify potential functional modules containing SPAC4H3.12c
If investigating potential telomere-associated functions for SPAC4H3.12c, consider these sophisticated experimental approaches:
Genetic interaction with telomere maintenance pathways:
Create double mutants with trt1+ (telomerase catalytic subunit) deletion
Design sensitive assays to detect synthetic growth defects or accelerated telomere shortening
Apply time-course experiments to monitor progressive telomere loss
Use epistasis analysis to place SPAC4H3.12c in telomere maintenance pathways
Telomere-specific chromatin immunoprecipitation:
Perform ChIP-seq with tagged SPAC4H3.12c to test for telomeric localization
Compare binding patterns with known telomere-associated proteins
Test localization changes in response to telomere stress
Analyze potential co-recruitment with DNA damage response proteins
Transcriptional response coupling:
Compare transcriptional profiles between SPAC4H3.12c and trt1+ deletion strains
Look for overlapping gene expression signatures, particularly in CESR genes
Analyze sequential gene expression waves during progressive telomere shortening
Test for SPAC4H3.12c-dependent expression changes in telomere-proximal genes
Telomere length regulation assays:
Measure telomere length in SPAC4H3.12c mutants using Southern blot analysis
Monitor telomere length stability over generations
Test for accelerated senescence phenotypes
Examine telomere recombination rates in the absence of SPAC4H3.12c
Cell cycle checkpoint analysis:
Investigate checkpoint activation in response to telomere dysfunction
Compare DNA damage responses between wild-type and SPAC4H3.12c mutants
Test genetic interactions with checkpoint genes (rad3+, chk1+)
Analyze cell cycle progression using flow cytometry and live-cell imaging
The following table summarizes gene expression changes observed in telomerase-deficient S. pombe strains, which could guide research on SPAC4H3.12c:
To comprehensively characterize SPAC4H3.12c, researchers should consider these integrated approaches:
Multi-omics data integration:
Combine transcriptomic, proteomic, metabolomic, and phenotypic data
Apply network analysis algorithms to identify functional modules
Develop predictive models of SPAC4H3.12c function based on integrated datasets
Design validation experiments targeting the highest confidence predictions
Comparative analysis across model systems:
Identify and characterize orthologs in other yeast species
Create cross-species complementation experiments
Analyze conservation of genetic interactions across species
Develop minimal systems for reconstituting SPAC4H3.12c function
Long-term evolution experiments:
Advanced imaging technologies:
Apply super-resolution microscopy to precisely localize SPAC4H3.12c
Use correlative light and electron microscopy for ultrastructural context
Implement live-cell imaging with engineered biosensors
Develop image analysis pipelines for detecting subtle phenotypes
Translational research connections:
Explore potential relevance to human disease through ortholog analysis
Investigate conservation of molecular mechanisms
Consider pharmaceutical applications if enzymatic activity is identified