Recombinant Schizosaccharomyces pombe Uncharacterized protein C4H3.12c (SPAC4H3.12c)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

SPAC4H3.12c is a hypothetical protein encoded by the gene SPAC4H3.12c in S. pombe. It is annotated as an "uncharacterized protein" due to insufficient experimental data on its molecular function, subcellular localization, or interaction partners. Key attributes include:

  • Uniprot ID: Q10219

  • Gene Name: SPAC4H3.12c

  • Expression Region: 1–101 amino acids (partial sequence)

  • AA Sequence: MIVSNRNYSHKNFNVTNNNFQVSCFNPILLKIILFLNTIVCIFYVYKIALCNEYIRFLAK CFLYILRCMSTVSLLSSAHKMNCCNFYSNYNILLVSSLFFF.

This protein is commercially available as a recombinant version, typically produced in E. coli or yeast systems, with purity levels exceeding 85% (SDS-PAGE verified) .

Stress Response and Cellular Pathways

In S. pombe, uncharacterized proteins often participate in stress adaptation. For example:

  • SPAC4H3.03c: A conserved bacterial-like protein involved in carbohydrate metabolism, though its role in S. pombe remains unclear .

  • CESR Genes: Core Environmental Stress Response genes (e.g., tps1, ntp1) regulate trehalose metabolism and NADPH production, critical for stress resistance .

SPAC4H3.12c is not explicitly linked to these pathways, but its recombinant availability suggests potential utility in studying stress-related mechanisms.

Comparative Gene Expression

In stress-response studies, genes like SPAC4H3.03c show elevated expression under KCl treatment (7.15-fold induction) . While SPAC4H3.12c is not listed in these datasets, such studies highlight the broader importance of uncharacterized proteins in S. pombe stress biology.

Challenges and Future Directions

The lack of functional data for SPAC4H3.12c underscores the need for targeted research. Key gaps include:

  1. Subcellular Localization: No experimental evidence exists for its localization (e.g., nucleus, mitochondria).

  2. Interaction Partners: Potential complexes with transcription factors (e.g., Atf1, Pcr1) or kinases (e.g., Sty1) remain unexplored .

  3. Functional Assays: Knockout or overexpression studies are required to elucidate its role in viability, stress resistance, or metabolic pathways.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
SPAC4H3.12cPutative uncharacterized protein SPAC4H3.12c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC4H3.12c
Target Protein Sequence
MIVSNRNYSHKNFNVTNNNFQVSCFNPILLKIILFLNTIVCIFYVYKIALCNEYIRFLAK CFLYILRCMSTVSLLSSAHKMNCCNFYSNYNILLVSSLFFF
Uniprot No.

Q&A

What is Schizosaccharomyces pombe and why is it valuable for studying uncharacterized proteins?

Schizosaccharomyces pombe, commonly known as fission yeast, is a unicellular eukaryotic organism that has become a powerful model system in molecular and cell biology research. S. pombe cells are rod-shaped, typically measuring 3-4 micrometers in diameter and 7-14 micrometers in length. The genome of S. pombe consists of approximately 14.1 million base pairs distributed across three chromosomes, containing an estimated 4,970 protein-coding genes and at least 450 non-coding RNAs .

S. pombe is particularly valuable for studying uncharacterized proteins because:

  • It maintains a relatively simple genome compared to higher eukaryotes while sharing significant conservation with human cellular processes

  • Over 70% of S. pombe protein-coding genes have identifiable human orthologs, with more than 1,500 associated with human diseases

  • Its genome contains fewer duplicated genes (only 5%) compared to budding yeast, simplifying functional analysis

  • The subcellular localization of nearly all S. pombe proteins has been documented using green fluorescent protein tagging

  • It serves as an excellent model for studying cell cycle regulation, DNA damage responses, and gene expression patterns

What genomic resources are available for investigating SPAC4H3.12c function?

When studying an uncharacterized protein like SPAC4H3.12c, researchers can leverage several genomic resources:

  • PomBase: The primary model organism database for S. pombe that integrates genomic, proteomic, and functional data. PomBase catalogs extensive information on gene function, protein characteristics, and mutant phenotypes that can provide context for understanding SPAC4H3.12c .

  • Genome-wide expression datasets: Resources like those generated in global transcriptional response studies can be analyzed to determine if SPAC4H3.12c shows expression patterns similar to genes of known function, particularly under various stress conditions .

  • Ortholog analysis: Comparative genomic approaches can identify potential orthologs of SPAC4H3.12c in other organisms, which may have better characterized functions.

  • Intron analysis: With 43% of S. pombe genes containing introns across 4,739 genes, analyzing the intron structure of SPAC4H3.12c may provide insights into potential alternative splicing events and protein variants .

How should I design experiments to determine if SPAC4H3.12c is involved in cell wall integrity?

Given that cell wall integrity is a crucial aspect of S. pombe biology, designing experiments to investigate SPAC4H3.12c's potential role requires a methodical approach:

  • Gene knockout/disruption: Create a SPAC4H3.12c deletion strain and assess cell morphology, growth characteristics, and sensitivity to cell wall stressors (such as Calcofluor White, Congo Red, and β-glucanases).

  • Phenotypic analysis: Compare the phenotype of SPAC4H3.12c deletion mutants with known cell wall mutants, particularly looking for similarities to β(1,3)-glucanosyl-transferase mutants (gas1Δ, gas2Δ, gas4Δ, gas5Δ) .

  • Osmotic support testing: Culture the deletion strain in media containing osmotic stabilizers (e.g., sorbitol or mannitol). If SPAC4H3.12c is essential for cell wall integrity, osmotic support may rescue growth defects, similar to what has been observed with gas1Δ mutants .

  • Enzymatic activity assays: Test the cell wall composition of mutant strains, particularly focusing on β(1,3)-glucan content and cross-linking, which are essential for cell wall integrity in S. pombe .

  • Gene expression analysis: Compare the expression profile of your deletion strain with wild-type under normal and stress conditions to identify potential compensatory mechanisms or affected pathways.

What expression systems work best for producing recombinant SPAC4H3.12c protein?

When expressing recombinant SPAC4H3.12c for functional or structural studies, consider these methodological approaches:

  • Homologous expression in S. pombe:

    • Advantages: Proper folding and post-translational modifications are more likely to be preserved

    • Recommended vectors: pREP series (containing nmt1 promoter with various strengths) or pJK148 for chromosomal integration

    • Expression control: The nmt1 promoter is thiamine-repressible, allowing for regulated expression

  • Heterologous expression systems:

    • E. coli: Use codon-optimized constructs and fusion tags (MBP, SUMO, or GST) to improve solubility

    • Insect cells: Baculovirus expression systems may be suitable if post-translational modifications are critical

    • Mammalian cells: Consider if human-like glycosylation patterns are essential for function

  • Purification strategy:

    • Design constructs with appropriate affinity tags (His, FLAG, or Strep-tag II)

    • Include a protease cleavage site between the tag and protein for tag removal

    • Consider using S. pombe-specific cell lysis buffers that account for its robust cell wall

  • Expression verification:

    • Western blotting with antibodies against the fusion tag

    • Mass spectrometry for protein identification

    • Activity assays if functional characteristics can be predicted

How can I determine if SPAC4H3.12c expression changes under environmental stress conditions?

Environmental stress response is a well-studied aspect of S. pombe biology. To determine if SPAC4H3.12c is stress-responsive:

  • Analyze existing transcriptomic datasets: Review global transcriptional response data, particularly focusing on whether SPAC4H3.12c shows expression patterns similar to known stress-responsive genes like those in the Core Environmental Stress Response (CESR) .

  • Design RT-qPCR experiments: Measure the expression levels of SPAC4H3.12c under various stress conditions:

    • Oxidative stress (H₂O₂)

    • Heat shock

    • Osmotic stress (sorbitol, NaCl)

    • Nutrient limitation

    • Cell wall stress (Calcofluor White, caspofungin)

  • Reporter gene assays: Fuse the SPAC4H3.12c promoter to a reporter gene (e.g., GFP or luciferase) to monitor expression changes in real-time under different conditions.

  • Northern blot analysis: For more precise quantification of transcript abundance and detection of alternative transcripts.

  • Dependency on stress response pathways: Test if expression changes are dependent on known stress response pathways by examining SPAC4H3.12c expression in key deletion mutants:

    • sty1Δ (MAP kinase pathway)

    • atf1Δ (transcription factor downstream of Sty1)

    • pap1Δ (oxidative stress response)

The following table summarizes potential experimental approaches based on known stress response gene categories in S. pombe:

Stress CategoryExample GenesExperimental ApproachRelevant Controls
Heat shockhsp16+, hsp9+Temperature shift (30°C to 39°C)Western blot for Hsp proteins
Oxidative stresscta1+, gst2+H₂O₂ treatment (0.5-1mM)Catalase activity assay
Cell wall stresseng1+, gas1+Calcofluor White, β-glucanaseMicroscopy for morphology
Carbon limitationfbp1+, eno102+Glucose depletionFbp1 enzyme activity
General stressCESR genesMultiple simultaneous stressorssty1Δ or atf1Δ strains

What approaches should I use to identify potential interaction partners of SPAC4H3.12c?

Identifying protein interaction partners is essential for understanding the function of uncharacterized proteins. For SPAC4H3.12c, consider these methodological approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Tag SPAC4H3.12c with an epitope tag (e.g., TAP, FLAG, or HA) at either N- or C-terminus

    • Express the tagged protein at endogenous levels using native promoter

    • Perform pull-down experiments under various cellular conditions

    • Identify interacting proteins by mass spectrometry

    • Validate key interactions with reciprocal tagging and co-immunoprecipitation

  • Yeast two-hybrid screening:

    • Use SPAC4H3.12c as bait against an S. pombe cDNA library

    • Consider both conventional and membrane-based Y2H systems depending on predicted topology

    • Validate positive interactions with complementary methods

  • Proximity-based labeling:

    • Fuse SPAC4H3.12c with BioID or APEX2 enzyme

    • Identify proximal proteins through biotinylation and streptavidin pull-down

    • Particularly useful for identifying weak or transient interactions

  • Co-localization studies:

    • Create fluorescently tagged versions of SPAC4H3.12c and candidate interactors

    • Perform live-cell imaging to assess spatial and temporal co-localization

    • Use FRET or BiFC for direct interaction assessment

  • Genetic interaction screening:

    • Cross SPAC4H3.12c deletion strain with genome-wide deletion library

    • Identify synthetic lethal, sick, or suppressor interactions

    • Particularly informative for placing SPAC4H3.12c in biological pathways

How do I analyze contradictory experimental results regarding SPAC4H3.12c localization?

When faced with contradictory data about protein localization, a systematic troubleshooting approach is essential:

  • Validate tagging approaches:

    • Compare N-terminal versus C-terminal tags (one may disrupt localization signals)

    • Test different fluorescent proteins (size and properties may affect localization)

    • Verify functionality of tagged proteins through complementation tests

    • Use multiple independent tagging methods (immunofluorescence with antibodies)

  • Consider cell cycle dependence:

    • S. pombe divides by medial fission, with distinct growth phases

    • Perform time-lapse imaging throughout the cell cycle

    • Synchronize cultures and examine localization at defined cell cycle stages

    • Co-stain with cell cycle markers (e.g., Sad1 for spindle pole bodies)

  • Assess environmental influences:

    • Test localization under various stress conditions

    • Consider that gene expression and protein localization may change under stress

    • Compare with proteins known to change localization under stress

  • Cross-reference with proteomic datasets:

    • Compare your findings with published proteome-wide localization studies

    • Examine localization data from orthologous proteins in related species

  • Genetic background effects:

    • Test localization in different strain backgrounds

    • Consider potential effects of auxotrophic markers or additional mutations

What cutting-edge experimental design approaches can resolve the function of SPAC4H3.12c?

For difficult-to-characterize proteins like SPAC4H3.12c, innovative experimental designs that integrate multiple approaches are often necessary:

  • Optimized CRISPR-Cas9 for S. pombe:

    • Implement multiplexed CRISPR-Cas9 editing to create precise mutations

    • Design an allelic series ranging from point mutations to domain deletions

    • Create conditional alleles using auxin-inducible degrons or temperature-sensitive mutations

    • Apply techniques from experimental design optimization literature to maximize information gain

  • Functional genomics with saturation mutagenesis:

    • Perform deep mutational scanning of SPAC4H3.12c

    • Develop high-throughput phenotypic assays

    • Map mutational effects to protein structure predictions

  • Integrative multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Apply network analysis to place SPAC4H3.12c in biological context

    • Use machine learning to identify patterns across datasets

    • Design follow-up experiments based on computational predictions

  • Single-cell approaches:

    • Implement single-cell RNA-seq to detect cell-to-cell variation

    • Perform high-content imaging with machine learning analysis

    • Use microfluidics to study protein dynamics in response to perturbations

  • Synthetic biology approaches:

    • Reconstitute potential pathways in heterologous systems

    • Design synthetic genetic circuits to test hypothesized functions

    • Create chimeric proteins with domains from characterized orthologs

The table below compares different experimental design strategies for uncharacterized proteins:

ApproachInformation YieldTechnical ComplexityResource RequirementsTime Investment
Traditional knockoutMediumLowLowMedium
CRISPR allelic seriesHighHighMediumHigh
Multi-omics integrationVery HighVery HighHighHigh
Synthetic reconstitutionMedium-HighHighMediumHigh
Evolutionary analysisMediumLowLowMedium

How can I determine if SPAC4H3.12c functions in the cell wall integrity pathway similar to β(1,3)-glucanosyl-transferases?

Based on the importance of cell wall integrity in S. pombe and the critical role of β(1,3)-glucanosyl-transferases, investigating SPAC4H3.12c's potential involvement requires sophisticated approaches:

  • Comparative phenotypic analysis:

    • Create precise deletion and point mutations in SPAC4H3.12c

    • Compare phenotypes with those of gas1Δ, gas2Δ, and gas5Δ mutants under identical conditions

    • Test for osmotic remediation of growth defects, which is characteristic of cell wall integrity mutants

    • Examine sensitivity to specific cell wall stressors (β-glucanases, Calcofluor White, Congo Red)

  • Biochemical activity testing:

    • Express and purify recombinant SPAC4H3.12c

    • Test for β(1,3)-glucanosyl-transferase activity using established assays

    • Compare substrate specificity with known Gas proteins (substrate length preferences, cleavage point, product size)

    • Analyze cell wall composition in mutants using specific enzymatic digestions and chromatographic methods

  • Genetic interaction mapping:

    • Create double mutants with known cell wall genes (gas1+, gas2+, gas4+, gas5+)

    • Test for synthetic lethality, sickness, or suppression

    • Perform genome-wide genetic interaction screening to place SPAC4H3.12c in the cell wall integrity network

  • Protein localization and dynamics:

    • Determine if SPAC4H3.12c localizes to sites of cell wall synthesis (cell tips during interphase, division septum during cytokinesis)

    • Compare localization patterns with known Gas proteins

    • Examine co-localization with cell wall synthesis machinery

  • Transcriptional profiling:

    • Compare gene expression changes in SPAC4H3.12c mutants with those in gas mutants

    • Look for activation of compensatory pathways typical of cell wall integrity disruption

    • Analyze expression under conditions known to stress the cell wall

The table below summarizes key characteristics of β(1,3)-glucanosyl-transferases in S. pombe for comparison with SPAC4H3.12c:

ProteinEssential for ViabilitySubstrate SpecificityExpression PatternLocalizationPhenotype
Gas1pYes (requires osmotic support)Prefers longer β(1,3)-glucan chainsConstitutiveCell peripherySevere cell lysis, morphology defects
Gas2pNoLimited chain length specificityCell cycle regulatedSeptumMinor morphological defects
Gas5pNoIntermediate specificityStress-responsiveCell tips, septumMild cell wall weakness
SPAC4H3.12c?????

What transcriptomic approaches can reveal the role of SPAC4H3.12c in global stress responses?

Given the extensive research on stress responses in S. pombe, sophisticated transcriptomic approaches can place SPAC4H3.12c in the context of global stress response networks:

  • Time-resolved RNA sequencing:

    • Design time-course experiments capturing early, intermediate, and late stress responses

    • Compare wild-type and SPAC4H3.12c deletion strains under multiple stress conditions

    • Identify genes with altered expression kinetics in the mutant

    • Analyze data using time-series clustering algorithms to identify co-regulated gene modules

  • Single-cell transcriptomics:

    • Apply scRNA-seq to capture cell-to-cell variation in stress responses

    • Identify potential heterogeneity masked in bulk RNA-seq experiments

    • Compare population-level responses between wild-type and SPAC4H3.12c mutants

  • Targeted transcription factor analysis:

    • Perform ChIP-seq for key stress-responsive transcription factors (Atf1, Pap1) in wild-type and mutant backgrounds

    • Identify differential binding patterns that may implicate SPAC4H3.12c in transcriptional regulation

    • Compare with known CESR gene regulation patterns

  • Integration with stress signaling pathways:

    • Compare transcriptional profiles of SPAC4H3.12c mutants with those of known stress pathway mutants (sty1Δ, atf1Δ)

    • Use epistasis analysis to place SPAC4H3.12c within or parallel to known stress pathways

    • Analyze phosphorylation-dependent signaling in wild-type versus mutant strains

  • Comparative transcriptomics across species:

    • Compare stress responses between S. pombe, S. cerevisiae, and other fungal species

    • Identify conserved versus species-specific responses involving SPAC4H3.12c orthologs

    • Use evolutionary conservation to prioritize functional hypotheses

The following table categorizes stress response genes in S. pombe based on previous studies and provides context for analyzing SPAC4H3.12c's potential involvement:

Stress Response CategoryExample GenesRegulatory FactorsPotential SPAC4H3.12c Connection
Core Environmental Stress Responsehsp16+, cta1+, gpd1+Sty1, Atf1Analyze co-regulation with CESR genes
Cell Wall Integrityeng1+, gas1+Pmk1, Atf1Compare with β-glucanosyl-transferase response
Oxidative Stressctt1+, trx1+Pap1, Prr1Test H₂O₂ sensitivity and gene expression
Osmotic Stressgpd1+, tps1+Sty1, Atf1Examine osmotic sensitivity phenotypes
Heat Shockhsp90+, hsp70+Hsf1Compare temperature sensitivity profiles

How can advanced protein structure prediction methods inform functional hypotheses about SPAC4H3.12c?

Modern computational approaches can provide valuable insights into the potential function of uncharacterized proteins:

  • AI-based structure prediction:

    • Apply AlphaFold2 or RoseTTAFold to predict SPAC4H3.12c structure

    • Compare predicted structure with known protein folds in the PDB

    • Identify potential catalytic sites or binding pockets

    • Use structure-based function prediction algorithms to generate hypotheses

  • Integrative domain analysis:

    • Identify conserved domains using HHpred, PFAM, and InterPro

    • Map conservation patterns onto structural models

    • Identify potential glycosylation, phosphorylation, or other post-translational modification sites

    • Compare with known cell wall proteins, particularly β(1,3)-glucanosyl-transferases

  • Molecular dynamics simulations:

    • Simulate protein behavior in different environments

    • Test potential substrate binding through virtual docking

    • Identify conformational changes that might be functionally relevant

    • Generate testable hypotheses about protein-protein interactions

  • Evolutionary analysis:

    • Perform phylogenetic analysis across fungal species

    • Identify patterns of co-evolution with other proteins

    • Map conserved versus variable regions to infer functional constraints

    • Apply ancestral sequence reconstruction to understand evolutionary trajectories

  • Network-based function prediction:

    • Integrate protein-protein interaction data

    • Apply gene neighborhood analysis across species

    • Use protein co-expression patterns to predict function

    • Identify potential functional modules containing SPAC4H3.12c

What experimental design principles should guide research on telomere-associated functions of SPAC4H3.12c?

If investigating potential telomere-associated functions for SPAC4H3.12c, consider these sophisticated experimental approaches:

  • Genetic interaction with telomere maintenance pathways:

    • Create double mutants with trt1+ (telomerase catalytic subunit) deletion

    • Design sensitive assays to detect synthetic growth defects or accelerated telomere shortening

    • Apply time-course experiments to monitor progressive telomere loss

    • Use epistasis analysis to place SPAC4H3.12c in telomere maintenance pathways

  • Telomere-specific chromatin immunoprecipitation:

    • Perform ChIP-seq with tagged SPAC4H3.12c to test for telomeric localization

    • Compare binding patterns with known telomere-associated proteins

    • Test localization changes in response to telomere stress

    • Analyze potential co-recruitment with DNA damage response proteins

  • Transcriptional response coupling:

    • Compare transcriptional profiles between SPAC4H3.12c and trt1+ deletion strains

    • Look for overlapping gene expression signatures, particularly in CESR genes

    • Analyze sequential gene expression waves during progressive telomere shortening

    • Test for SPAC4H3.12c-dependent expression changes in telomere-proximal genes

  • Telomere length regulation assays:

    • Measure telomere length in SPAC4H3.12c mutants using Southern blot analysis

    • Monitor telomere length stability over generations

    • Test for accelerated senescence phenotypes

    • Examine telomere recombination rates in the absence of SPAC4H3.12c

  • Cell cycle checkpoint analysis:

    • Investigate checkpoint activation in response to telomere dysfunction

    • Compare DNA damage responses between wild-type and SPAC4H3.12c mutants

    • Test genetic interactions with checkpoint genes (rad3+, chk1+)

    • Analyze cell cycle progression using flow cytometry and live-cell imaging

The following table summarizes gene expression changes observed in telomerase-deficient S. pombe strains, which could guide research on SPAC4H3.12c:

Gene CategoryExpression in trt1ΔExamplesPotential SPAC4H3.12c Connection
Carbohydrate metabolismUpregulatedeno102+, fbp1+Analyze in SPAC4H3.12c mutants
Stress responseUpregulatedhsp16+, cta1+Compare stress sensitivity profiles
Cell organizationDifferentially regulatedeng1+Test cell wall integrity connections
Meiosis/sporulationUpregulatedmeu3RC+, meu8+Examine under nutrient limitation
Energy productionUpregulatedMultiple mitochondrial genesTest respiratory capacity

What integrative research approaches will best advance our understanding of SPAC4H3.12c?

To comprehensively characterize SPAC4H3.12c, researchers should consider these integrated approaches:

  • Multi-omics data integration:

    • Combine transcriptomic, proteomic, metabolomic, and phenotypic data

    • Apply network analysis algorithms to identify functional modules

    • Develop predictive models of SPAC4H3.12c function based on integrated datasets

    • Design validation experiments targeting the highest confidence predictions

  • Comparative analysis across model systems:

    • Identify and characterize orthologs in other yeast species

    • Create cross-species complementation experiments

    • Analyze conservation of genetic interactions across species

    • Develop minimal systems for reconstituting SPAC4H3.12c function

  • Long-term evolution experiments:

    • Subject SPAC4H3.12c mutants to prolonged selection under various conditions

    • Identify compensatory mutations that rescue phenotypes

    • Apply experimental design optimization to maximize information gain

    • Use adaptive laboratory evolution to reveal hidden functions

  • Advanced imaging technologies:

    • Apply super-resolution microscopy to precisely localize SPAC4H3.12c

    • Use correlative light and electron microscopy for ultrastructural context

    • Implement live-cell imaging with engineered biosensors

    • Develop image analysis pipelines for detecting subtle phenotypes

  • Translational research connections:

    • Explore potential relevance to human disease through ortholog analysis

    • Investigate conservation of molecular mechanisms

    • Consider pharmaceutical applications if enzymatic activity is identified

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.