Recombinant Schizosaccharomyces pombe Uncharacterized protein C513.04 (SPAC513.04)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Identification

SPAC513.04 is a gene within the S. pombe genome, annotated as encoding an "uncharacterized protein" or "sequence orphan." This designation reflects the absence of experimentally validated functional or structural data . Key identifiers include:

AttributeValue
Gene NameSPAC513.04
Alternative NamesUncharacterized protein C513.04
Host Systems for ProductionE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE analysis)

Recombinant Production and Properties

SPAC513.04 is synthesized via recombinant protein expression systems, with multiple production platforms available:

Table 1: Recombinant SPAC513.04 Protein Products

Product TypeHost SystemPurityApplications
Full-length recombinant proteinCell-free expression≥85% (SDS-PAGE)Structural studies, bioassays
Partial recombinant proteinE. coli/yeast≥85% (SDS-PAGE)Functional assays, epitope mapping
Polyclonal antibodyRabbitAffinity-purifiedELISA, Western blotting
  • Full-length protein: Produced via cell-free systems, this form retains native folding and activity, suitable for enzymatic or binding assays.

  • Partial protein: Truncated variants enable targeted studies of specific domains.

  • Antibody: Rabbit-derived polyclonal antibodies enable immunoblotting and ELISA detection, confirming protein presence in S. pombe lysates .

Functional Insights and Research Gaps

  • Stress response pathways: Analogous to other S. pombe proteins (e.g., SPAC869.09, zym1) implicated in stress responses .

  • Metabolic regulation: Possible involvement in carbohydrate metabolism or iron homeostasis, given overlapping functional categories in S. pombe gene clusters .

Table 2: Potential Functional Categories (Inferred from S. pombe Gene Clusters)

Functional CategoryRelevant GenesExample Processes
Stress responseSPAC869.09, zym1Oxidative stress, heat shock
Iron homeostasisGrx4, Fep1, Php4Iron uptake, storage, regulation
RNA metabolismaes1, SPBC530.08RNA processing, stability

While SPAC513.04 has not been linked to these pathways experimentally, its genomic context suggests possible involvement in conserved eukaryotic processes.

Applications in Research

Despite limited functional data, SPAC513.04 recombinant proteins and antibodies serve as tools for:

  • Epitope mapping: Identifying regions critical for interactions or enzymatic activity.

  • Immunoblotting: Detecting endogenous or overexpressed protein in S. pombe cell lysates.

  • Structural studies: X-ray crystallography or cryo-EM to resolve tertiary structure.

Challenges and Future Directions

  • Functional annotation: Reverse genetics (e.g., gene knockout or RNAi) is needed to elucidate SPAC513.04’s role in S. pombe.

  • Comparative genomics: Homology searches against Saccharomyces cerevisiae or metazoan proteins may reveal conserved domains.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
SPAC513.04; Uncharacterized protein C513.04
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC513.04
Target Protein Sequence
MTAKMAEPLYFRIWSSLNIICLMVTFLNVQLSKTPIVLMPLFIALLKNNRKRETKKQTIS VLVQKREEKTKLVLDDANNHNHAFLYHCQYLGQKKHVVIQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is known about the structural characteristics of SPAC513.04?

SPAC513.04 is a relatively small protein with 100 amino acids in its full-length form. It is available as a recombinant protein with a His-tag when expressed in E. coli expression systems . The three-dimensional structure has not been fully characterized in the current literature. Researchers typically employ standard structural analysis techniques such as circular dichroism (CD) spectroscopy for secondary structure estimation, fluorescence spectroscopy for tertiary structure assessment, and potentially X-ray crystallography or NMR for detailed structural determination. For initial characterization, bioinformatic approaches comparing sequence homology with structurally characterized proteins can provide preliminary insights into possible structural domains.

How does SPAC513.04 fit into the broader context of S. pombe essential genes?

Based on gene deletion studies in S. pombe, approximately 17.5% of genes are essential for vegetative growth, with an interval of confidence (P90) of 9.5%–25.5% . Whether SPAC513.04 falls into this category would require targeted gene deletion experiments. The essentiality of genes in S. pombe has been found to correlate with their evolutionary conservation and when they appeared in the tree of life . Genes that are highly conserved across multiple species are more likely to be essential. Researchers should note that within certain genomic regions, clustering of essential genes has been observed, with one study finding eight of nine genes located within an 18 kb region that could not be deleted .

What are the standard methods for expressing and purifying recombinant SPAC513.04?

For expression and purification of recombinant SPAC513.04, the following methodological approach is typically employed:

  • Expression System: E. coli is the preferred host for recombinant expression

  • Affinity Tag: His-tag facilitates purification via immobilized metal affinity chromatography (IMAC)

  • Purification Protocol:

    • Cell lysis using sonication or French press

    • Clarification of lysate through centrifugation

    • IMAC purification using Ni-NTA or similar resin

    • Size exclusion chromatography for further purification

    • Verification of purity through SDS-PAGE and Western blotting

Researchers should optimize expression conditions including temperature, induction time, and IPTG concentration to maximize yield and solubility.

How should experiments be designed to investigate SPAC513.04 function?

When designing experiments to elucidate SPAC513.04 function, a systematic approach based on sound experimental design principles is essential:

  • Define your variables clearly: Identify independent variables (e.g., protein concentration, temperature, pH) and dependent variables (e.g., growth rate, protein interaction)

  • Formulate a specific, testable hypothesis based on preliminary data or bioinformatic analysis

  • Design appropriate experimental treatments to manipulate your independent variables

  • Establish proper control groups: negative controls (without SPAC513.04), positive controls (with a protein of known function), and vehicle controls

  • Plan measurements of your dependent variables with appropriate techniques and timepoints

For example, when investigating potential protein interactions:

Independent VariableExperimental TreatmentControlDependent VariableMeasurement Method
Presence of SPAC513.04Recombinant SPAC513.04Buffer onlyBinding affinityPull-down assay/SPR
SPAC513.04 concentrationSerial dilutionsNo proteinInteraction kineticsBLI or ITC
Temperature25°C, 30°C, 37°CSame temps without proteinComplex formationSize exclusion chromatography

What are the best approaches for studying SPAC513.04 in the context of gene deletion experiments?

For gene deletion studies of SPAC513.04 in S. pombe, researchers should consider the following methodological approach:

  • PCR-based gene deletion procedure using appropriate selectable markers (e.g., geneticin resistance)

  • Design of deletion cassettes with homology regions flanking the SPAC513.04 gene

  • Transformation of S. pombe cells and selection of transformants

  • Verification of successful deletion through PCR and Southern blot analysis

  • Phenotypic characterization of deletion mutants

Researchers should be aware that systematic deletion of all fission yeast genes may be challenging using PCR approaches, as demonstrated by previous studies where eight of nine genes within an 18 kb region could not be deleted . Alternative approaches such as conditional knockout systems (e.g., using promoter substitution) might be necessary if direct deletion is not successful. The essentiality of a gene correlates with its evolutionary conservation, and this should be considered when interpreting deletion results .

How can contradictory findings about SPAC513.04 in the literature be systematically addressed?

When faced with contradictory findings about SPAC513.04 in the literature, researchers should employ a structured approach to identify and resolve discrepancies:

  • Categorize contextual characteristics that might explain contradictions :

    • Internal factors (species differences, genetic background variations)

    • External factors (experimental conditions, reagent sources)

    • Endogenous/exogenous factors (expression levels, post-translational modifications)

    • Known controversies in the field

    • Methodological differences between studies

  • Examine specific context elements that commonly lead to contradictions :

    • Different experimental models or cell lines

    • Variation in protein expression systems

    • Temporal context differences

    • Environmental conditions

    • Incomplete context reporting

  • Design experiments specifically to test competing hypotheses, controlling for the identified contextual variables

Many contradictions arise from underspecified context in published studies, including differences in species, temporal context, and environmental phenomena . Carefully documenting and reporting all relevant experimental conditions is essential for preventing future contradictions.

What approaches should be used to identify potential interaction partners of SPAC513.04?

To identify interaction partners of SPAC513.04, a multi-faceted approach combining in vitro and in vivo methods is recommended:

  • Computational prediction:

    • Sequence-based interaction prediction

    • Structural homology modeling

    • Co-expression analysis from transcriptomic data

  • In vitro screening:

    • Yeast two-hybrid (Y2H) screening

    • Pull-down assays using recombinant His-tagged SPAC513.04

    • Protein microarray screening

  • In vivo validation:

    • Co-immunoprecipitation (Co-IP) with tagged SPAC513.04

    • Bimolecular fluorescence complementation (BiFC)

    • Proximity labeling methods (BioID, APEX)

  • Systematic analysis:

    • Confirmation of interactions through multiple independent methods

    • Characterization of interaction domains

    • Functional relevance assessment through phenotypic analysis

Each potential interaction should be validated using at least two independent methods to minimize false positives. Researchers should be aware that uncharacterized proteins often require more extensive validation of interaction partners compared to well-studied proteins.

How can evolutionary conservation analysis enhance understanding of SPAC513.04 function?

Evolutionary conservation analysis provides valuable insights into protein function through assessment of evolutionary patterns:

  • Phylogenetic profiling:

    • Determine presence/absence patterns across species

    • Identify co-evolving gene families

    • Map to the tree of life to estimate evolutionary age

  • Sequence conservation analysis:

    • Multiple sequence alignment of homologs

    • Identification of conserved domains and motifs

    • Calculation of selection pressure (dN/dS ratios)

  • Structural conservation:

    • Comparison with structural homologs

    • Identification of conserved binding pockets or catalytic sites

    • Prediction of functional constraints

The essentiality of genes in S. pombe has been found to correlate with their evolutionary conservation status . Ancient genes that have been conserved throughout evolution are more likely to be essential, while those that have been lost in certain lineages or appeared more recently may have specialized non-essential functions. This evolutionary context can guide functional hypotheses for SPAC513.04.

What are the most effective strategies for functional characterization of SPAC513.04?

For comprehensive functional characterization of an uncharacterized protein like SPAC513.04, a multi-modal strategy is recommended:

  • Genetic approaches:

    • Gene deletion or conditional knockout analysis

    • Overexpression studies

    • Genetic interaction mapping (synthetic lethality/sickness)

    • CRISPR-based functional screening

  • Biochemical characterization:

    • Enzymatic activity assays (if predicted by sequence or structure)

    • Post-translational modification analysis

    • Protein stability and half-life determination

    • Subcellular localization studies

  • Phenotypic profiling:

    • Growth assays under various conditions

    • Cell cycle analysis

    • Stress response evaluation

    • Microscopic analysis of cellular morphology

  • Omics integration:

    • Transcriptomics after deletion/overexpression

    • Proteomics to identify changes in protein abundance

    • Metabolomics to detect metabolic changes

This systematic approach enables researchers to generate and test multiple hypotheses about protein function simultaneously. For uncharacterized proteins, starting with broader analyses and progressively focusing on specific functional aspects based on initial findings is most efficient.

How should contradictory experimental results with SPAC513.04 be reconciled?

When facing contradictory results in experiments with SPAC513.04, a systematic analytical approach is necessary:

  • Categorize contradiction types :

    • Direct contradictions (A causes B vs. A prevents B)

    • Contextual contradictions (A causes B in context X but not in context Y)

    • Temporal contradictions (A causes B early but prevents B later)

    • Dose-dependent contradictions (Low A causes B but high A prevents B)

  • Examine experimental conditions that might explain discrepancies :

    • Different expression systems or protein preparations

    • Variation in experimental conditions (pH, temperature, salt concentration)

    • Presence of different cofactors or binding partners

    • Different measurement techniques or timepoints

  • Employ meta-analytical approaches:

    • Standardize results across experiments

    • Weight evidence based on methodological rigor

    • Identify patterns in contradictory findings

  • Design critical experiments:

    • Directly test competing hypotheses

    • Control for all variables identified as potential sources of contradiction

    • Include appropriate positive and negative controls

As demonstrated in biomedical literature analysis, most conflicts are due to underspecified context, including differences in species, temporal context, and environmental conditions . Thorough documentation and reporting of all experimental parameters is essential for reconciliation of contradictory findings.

What statistical approaches are most appropriate for analyzing experiments with SPAC513.04?

For rigorous statistical analysis of experiments involving SPAC513.04, researchers should consider:

  • Experimental design-based statistics:

    • Power analysis to determine appropriate sample sizes

    • Randomization and blinding procedures where applicable

    • Appropriate control selection based on experimental design

  • Data analysis methods:

    • Normality testing to determine appropriate parametric/non-parametric tests

    • Multiple comparison corrections for experiments with multiple conditions

    • Effect size calculations in addition to p-values

  • Advanced statistical approaches:

    • Bayesian analysis for integrating prior knowledge with new data

    • Multivariate analysis for experiments with multiple dependent variables

    • Time-series analysis for temporal experiments

  • Reporting standards:

    • Complete reporting of all statistical tests performed

    • Inclusion of raw data or access to repositories

    • Transparent disclosure of outlier handling

When analyzing gene deletion experiments, researchers should be aware that approximately 17.5% of S. pombe genes are essential with a confidence interval (P90) of 9.5%–25.5% . This baseline information can inform Bayesian approaches to data analysis when investigating the potential essentiality of SPAC513.04.

What are the main technical challenges in studying SPAC513.04?

Researchers working with SPAC513.04 face several technical challenges:

  • Expression and purification:

    • Optimizing soluble expression in E. coli systems

    • Ensuring proper folding of the recombinant protein

    • Maintaining stability during purification and storage

  • Functional characterization:

    • Lack of known homologs with characterized functions

    • Absence of predictable functional domains

    • Limited information about interacting partners or pathways

  • Genetic manipulation:

    • Potential difficulties with gene deletion if located in problematic genomic regions

    • Design of specific antibodies for an uncharacterized protein

    • Creation of functional tagged versions without disrupting activity

  • Data interpretation:

    • Reconciling potentially contradictory results from different approaches

    • Distinguishing direct effects from indirect consequences

    • Connecting molecular activities to cellular phenotypes

Addressing these challenges requires a multifaceted approach combining biochemical, genetic, and computational methods, with careful attention to experimental design and controls .

How can emerging technologies advance our understanding of SPAC513.04?

Emerging technologies offer new possibilities for characterizing SPAC513.04:

  • Structural biology advances:

    • Cryo-EM for structural determination with minimal sample requirements

    • AlphaFold and related AI systems for structure prediction

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Genome editing technologies:

    • CRISPR-based approaches for precise genetic manipulation

    • Base editing for introducing specific mutations

    • CRISPRi/CRISPRa for reversible gene expression modulation

  • Single-cell and spatial technologies:

    • Single-cell transcriptomics to identify cell-specific responses

    • Spatial transcriptomics for localized expression patterns

    • Super-resolution microscopy for precise localization studies

  • Systems biology integration:

    • Multi-omics data integration approaches

    • Network analysis tools for contextualizing function

    • Machine learning for predicting functional interactions

These technologies can overcome limitations of traditional approaches, particularly for uncharacterized proteins where conventional methods may provide limited insights. Integration of multiple technological approaches is likely to yield the most comprehensive understanding of SPAC513.04 function.

How should research on SPAC513.04 be prioritized within the broader context of S. pombe studies?

When prioritizing research on SPAC513.04, consider the following strategic approach:

  • Contextual assessment:

    • Genomic location analysis (proximity to known essential genes)

    • Evolutionary conservation profiling (correlation with essentiality)

    • Expression pattern analysis (constitutive vs. condition-specific)

  • Systematic screening:

    • Inclusion in genome-wide deletion projects if not previously characterized

    • High-throughput phenotypic screening under diverse conditions

    • Genetic interaction mapping to identify functional relationships

  • Resource allocation strategy:

    • Initial low-cost, high-throughput approaches for preliminary characterization

    • More resource-intensive focused studies if preliminary data indicates significance

    • Collaborative approaches leveraging complementary expertise

  • Integration with existing knowledge:

    • Connection to known pathways in S. pombe

    • Comparison with homologs in other model organisms

    • Potential relevance to conserved cellular processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.