Recombinant Schizosaccharomyces pombe Uncharacterized protein C553.06 (SPCC553.06)

Shipped with Ice Packs
In Stock

Description

Introduction

Schizosaccharomyces pombe, also known as fission yeast, is a eukaryotic microorganism that serves as a valuable model organism in molecular and cellular biology . SPCC553.06 is an uncharacterized protein within S. pombe, designated by its genomic locus tag . Identifying the function and characteristics of such proteins is essential to understanding the complex biological processes within the cell and the broader context of cellular networks .

General Information

Table 1: Key aspects of Protein Structure

Structure LevelDescription
PrimaryAmino acid sequence
Secondary$$\alpha$$-helices and $$\beta$$-pleated sheets
TertiaryThree-dimensional shape of a single protein
QuaternaryArrangement of multiple polypeptide chains in multi-subunit proteins

Research Findings

Research has identified several transcription factors that play novel roles in the activation or inhibition of flocculation, including Rfl1 . Deletion of rfl1 (SPBC15D4.02), which encodes an uncharacterized fungal Zn(2)-Cys(6) transcription factor, resulted in strong flocculation . Microarray expression profiling revealed good overlap in the upregulation of several flocculin genes, while ChIP-chip analysis indicated that these transcription factors bound to some of the flocculin gene promoters .

Techniques for Studying Uncharacterized Proteins

  • Bioinformatics: Using computer programs to predict protein sequence, structure, and function from amino acid sequences (or RNA or DNA sequences) .

  • Microarray expression profiling: Monitoring the expression levels of thousands of genes simultaneously .

  • ChIP-chip analysis: Identifying the binding sites of DNA-binding proteins on a genome-wide scale .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
SPCC553.06; Uncharacterized protein C553.06
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-271
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC553.06
Target Protein Sequence
ASWNVEEGTLQLSSQDLESENAYDLKFSQIQSSTVYELTGDETLNLKFTCILNGTGAIPH QAHLLLSDTEHPTLAVIYPASVSQGGVASLELRLFDIPTSLLRSDSTLTAKLLVASFGET IPFSLPLGQLSINVPPSLYHKAEFSPLDELSPKEVILHTFSPPPKRANYFLSICFSVSVV VSLIGLLGVWQKLLPKSNVYSVSSSSFARTFGFASLAVAEILLFIYWTSLSIFQFGAYAA GVAIMCGIAAKSL
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SPCC553.06 and why is it of interest to researchers?

SPCC553.06 is an uncharacterized protein from the fission yeast Schizosaccharomyces pombe (strain 972 / ATCC 24843). Despite being classified as "uncharacterized," this protein is of significant interest to researchers studying fundamental cellular processes in eukaryotic model organisms. Fission yeast has emerged as a powerful tractable system for studying various cellular mechanisms including DNA damage repair, cell cycle regulation, and metabolic pathways . Uncharacterized proteins like SPCC553.06 represent knowledge gaps in our understanding of the proteome and may have important roles in cellular functions that have not yet been elucidated. The protein sequence suggests it contains transmembrane domains, indicating it may function in membrane-associated processes or signaling pathways.

What are the established methods for expressing and purifying recombinant SPCC553.06?

The recombinant SPCC553.06 protein can be produced using several expression systems. Based on available information, the following methods have been established:

  • In vitro E. coli expression system: This appears to be a primary method for producing the recombinant protein . This approach typically involves:

    • Cloning the SPCC553.06 gene into an appropriate expression vector

    • Transformation into a suitable E. coli strain optimized for protein expression

    • Induction of protein expression using IPTG or other inducers

    • Cell lysis and protein extraction

    • Purification using affinity chromatography based on the fusion tag

  • Tag selection considerations: The tag type is often determined during the production process to optimize for protein solubility and function . Common tags include:

    • Hexahistidine (6×His) for nickel affinity purification

    • GST (glutathione S-transferase) for improved solubility and glutathione-based purification

    • MBP (maltose-binding protein) for enhanced solubility of membrane proteins

For membrane-associated proteins like SPCC553.06, additional considerations include using detergents during extraction and purification steps to maintain protein solubility and native conformation.

What experimental approaches are recommended for studying the cellular localization of SPCC553.06?

To determine the cellular localization of SPCC553.06, researchers should consider a multi-faceted approach:

  • Fluorescent protein tagging:

    • C-terminal or N-terminal GFP/mCherry fusion constructs can be generated and expressed in S. pombe

    • The tagging method should follow established protocols for fission yeast , considering that:

      • C-terminal tagging can be achieved by PCR-based gene targeting

      • The cellular distribution can be visualized using fluorescence microscopy

  • Immunolocalization:

    • Generate antibodies against the recombinant SPCC553.06 protein

    • Use immunofluorescence microscopy with appropriate fixation methods optimized for membrane proteins

    • Co-stain with known organelle markers to determine precise subcellular localization

  • Subcellular fractionation:

    • Isolate different cellular compartments (membrane, cytosol, nucleus, etc.)

    • Detect the presence of SPCC553.06 in these fractions using Western blotting

    • This approach can complement imaging methods to confirm localization results

  • Bioinformatic prediction:

    • Use computational tools to predict subcellular localization based on sequence features

    • Tools like TMHMM, Phobius, or DeepLoc can predict transmembrane domains and likely cellular compartments

Given the sequence characteristics suggesting transmembrane domains, special attention should be paid to methods optimized for membrane protein localization, including appropriate detergents and fixation protocols.

What genetic approaches can be used to investigate the function of SPCC553.06 in S. pombe?

Several genetic approaches can be employed to elucidate the function of SPCC553.06:

  • Gene deletion analysis:

    • Generate a SPCC553.06 deletion strain using PCR-based gene targeting methods

    • Perform comprehensive phenotypic analysis under various conditions (different media, temperatures, stresses)

    • Monitor growth rates, cell morphology, cell cycle progression, and stress responses

    • Compare results with wild-type controls to identify phenotypic differences

  • Overexpression studies:

    • Clone SPCC553.06 into an inducible expression vector (e.g., nmt1 promoter-based)

    • Analyze phenotypic consequences of overexpression

    • Monitor potential cellular defects in growth, division, or organelle morphology

  • Genetic interaction screening:

    • Cross SPCC553.06 deletion strain with a library of other gene deletion mutants

    • Identify synthetic lethal or synthetic sick interactions

    • These interactions can reveal functional relationships and biological pathways

  • Transcriptional analysis:

    • Perform RNA-seq on SPCC553.06 deletion or overexpression strains

    • Identify genes with altered expression profiles

    • Pathway enrichment analysis can suggest biological processes affected

  • Conditional alleles:

    • Generate temperature-sensitive or auxin-inducible degron versions of SPCC553.06

    • This allows temporal control of protein inactivation for studying essential functions

How can protein interaction studies help characterize the function of SPCC553.06?

Protein interaction studies are crucial for understanding the functional context of uncharacterized proteins:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged versions of SPCC553.06 (e.g., TAP-tag, FLAG-tag, or GFP-tag)

    • Perform immunoprecipitation followed by mass spectrometry

    • Identify interacting protein partners

    • Methods like GFP-TRAP purification have been successfully used in S. pombe

  • Yeast two-hybrid screening:

    • Use SPCC553.06 as bait against an S. pombe cDNA library

    • Identify binary protein interactions

    • Verify interactions using alternative methods such as co-immunoprecipitation

  • Proximity labeling:

    • Fuse SPCC553.06 with BioID or APEX2

    • These enzymes biotinylate proteins in proximity to the fusion protein

    • Identify proximal proteins through streptavidin pull-down and mass spectrometry

  • Co-evolution analysis:

    • Apply computational approaches to predict protein interactions based on evolutionary patterns

    • Recent advances in coevolution analysis have identified numerous previously uncharacterized protein-protein interactions

    • This method can be particularly useful for membrane proteins that are challenging to study with traditional methods

  • Cross-linking mass spectrometry:

    • Use chemical cross-linkers to stabilize transient protein interactions

    • Identify interaction partners through mass spectrometry

    • This approach can provide structural information about the interaction interfaces

How might SPCC553.06 be involved in cellular stress responses or metabolic regulation?

Recent studies on uncharacterized proteins in S. pombe suggest potential roles in stress response and metabolic regulation:

  • Metabolic pathway analysis:

    • Research has shown that certain uncharacterized proteins in S. pombe display altered expression patterns under metabolic stressors like metformin treatment

    • To investigate SPCC553.06's role:

      • Measure its expression levels under various metabolic conditions (glucose limitation, nitrogen starvation)

      • Analyze phenotypes of deletion mutants in different carbon and nitrogen sources

      • Integrate with metabolomic data to identify affected pathways

  • Stress response characterization:

    • Examine SPCC553.06 expression under various stress conditions:

      • Oxidative stress (H₂O₂, menadione)

      • DNA damage (UV, MMS, hydroxyurea)

      • Heat shock

      • Osmotic stress

    • Compare growth and survival of wild-type and SPCC553.06 deletion strains under these conditions

  • Cell cycle regulation:

    • Investigate potential links to cell cycle control by:

      • Synchronizing cells and monitoring SPCC553.06 expression throughout the cell cycle

      • Analyzing cell cycle progression in deletion mutants

      • Testing for genetic interactions with known cell cycle regulators

    • S. pombe is a powerful model system for studying mitotic recombination and DNA damage repair , making it valuable for investigating potential roles in these processes

What computational approaches can predict potential functions of SPCC553.06?

Several computational methods can provide insights into the potential functions of SPCC553.06:

  • Functional annotation with specialized tools:

    • Tools like PANNZER2 have been successfully used for annotating uncharacterized proteins in S. pombe

    • This approach involves:

      • Sequence similarity searches against UniProtKB

      • Filtering of sequence neighborhoods based on multiple criteria

      • GO annotation predictions for biological processes, molecular functions, and cellular components

      • Generation of free text description predictions

  • Structural prediction and analysis:

    • Use AlphaFold2 or RoseTTAFold to generate structural models

    • Compare predicted structures with known protein domains

    • Analyze potential binding sites or catalytic regions

    • Molecular dynamics simulations to study conformational flexibility

  • Evolutionary analysis:

    • Identify orthologs across species

    • Analyze conservation patterns to identify functionally important residues

    • Study co-evolution with other proteins to predict interaction networks

  • Network-based function prediction:

    • Integrate available protein-protein interaction data

    • Use network topology to infer functions based on the "guilt by association" principle

    • Leverage STRING database connections (4896.SPCC553.06.1)

  • Expression correlation analysis:

    • Analyze co-expression patterns with genes of known function

    • Identify conditions where SPCC553.06 shows significant regulation

    • Infer potential functions from co-expressed gene clusters

How does the study of SPCC553.06 contribute to our understanding of the S. pombe proteome?

The characterization of SPCC553.06 contributes significantly to our understanding of the S. pombe proteome in several ways:

  • Completion of the functional proteome:

    • Despite its popularity as a model organism, many S. pombe proteins remain uncharacterized

    • Functional annotation of these proteins is essential for a comprehensive understanding of cellular processes

    • Systematic studies of uncharacterized proteins like SPCC553.06 help fill knowledge gaps in the proteome

  • Evolutionary insights:

    • Comparing the functions of uncharacterized proteins across different yeast species (e.g., S. pombe and S. cerevisiae)

    • Understanding evolutionary conservation and divergence of protein functions

    • Identifying species-specific adaptations in cellular processes

  • Systems biology integration:

    • Placing SPCC553.06 within the larger context of cellular pathways and networks

    • Contributing to comprehensive models of cellular functions

    • Enhancing predictive capabilities for cellular responses to environmental changes

  • Comparison with human proteins:

    • Many S. pombe proteins have human orthologs

    • Functional characterization in yeast can provide insights into human protein functions

    • Potential implications for understanding human disease mechanisms

What methodological challenges exist in studying transmembrane proteins like SPCC553.06 in S. pombe?

Studying transmembrane proteins in S. pombe presents several unique challenges:

  • Protein expression and purification challenges:

    • Membrane proteins often have low expression levels

    • Maintaining proper folding and preventing aggregation requires specialized conditions

    • Optimizing detergent selection for extraction and purification

    • Potential strategies include:

      • Testing multiple expression systems (E. coli, insect cells, cell-free systems)

      • Using fusion partners that enhance solubility

      • Exploring nanodiscs or amphipols for maintaining native conformations

  • Structural characterization limitations:

    • Traditional structural biology methods (X-ray crystallography, NMR) are challenging for membrane proteins

    • Alternative approaches include:

      • Cryo-EM for larger complexes

      • Computational modeling with membrane-specific force fields

      • Limited proteolysis coupled with mass spectrometry

  • Functional assays for membrane proteins:

    • Developing assays that maintain the native membrane environment

    • Potential approaches include:

      • Liposome reconstitution

      • Use of membrane vesicles

      • Whole-cell assays with readouts specific to membrane functions

  • Localization challenges:

    • Distinguishing between different cellular membranes

    • Potential solutions:

      • Co-localization with established membrane markers

      • Immunoelectron microscopy for high-resolution localization

      • Subcellular fractionation with membrane-specific markers

  • Genetic manipulation considerations:

    • Deletion of membrane proteins may have pleiotropic effects

    • Tagged versions may have altered localization or function

    • Recommendations:

      • Test multiple tagging strategies (N-terminal, C-terminal, internal)

      • Validate functionality of tagged versions

      • Consider conditional alleles for essential genes

How might characterization of SPCC553.06 contribute to broader fields beyond S. pombe biology?

The characterization of SPCC553.06 has potential implications for multiple research fields:

  • Evolutionary cell biology:

    • Understanding conserved membrane protein functions across eukaryotes

    • Insights into the evolution of membrane-associated processes

    • Comparative analysis with related proteins in other organisms

  • Translational research potential:

    • If human orthologs exist, findings could inform human cell biology

    • Possible relevance to disease mechanisms involving related membrane proteins

    • Drug target identification for conditions related to membrane protein dysfunction

  • Methodological advancements:

    • Development of improved techniques for studying membrane proteins

    • Optimization of approaches that could be applied to other challenging protein classes

    • Advancement of functional genomics approaches for uncharacterized proteins

  • Systems biology integration:

    • Contributing to comprehensive cellular models

    • Understanding how membrane proteins integrate with other cellular components

    • Insights into cellular response coordination across different compartments

What novel experimental approaches could accelerate functional characterization of uncharacterized proteins like SPCC553.06?

Emerging technologies offer new opportunities for functional characterization:

  • CRISPR-based functional genomics:

    • Application of CRISPR-Cas9 screens in S. pombe

    • Investigating genetic interactions at a genome-wide scale

    • Creating conditional alleles using CRISPR interference or activation

  • Single-cell approaches:

    • Single-cell transcriptomics to identify cell-to-cell variability in responses

    • Single-cell proteomics for protein level analysis

    • Microfluidics-based assays for measuring individual cell phenotypes

  • Advanced imaging techniques:

    • Super-resolution microscopy for detailed localization studies

    • Live-cell imaging to track dynamic behaviors

    • Multi-color imaging to study co-localization with multiple markers simultaneously

  • Integrative -omics approaches:

    • Combining proteomics, transcriptomics, and metabolomics data

    • Correlation of protein levels with cellular phenotypes

    • Network-based integration of multiple data types

  • High-throughput phenotyping:

    • Automated microscopy for morphological analysis

    • Growth assays under hundreds of conditions using robotics

    • Metabolic profiling under various environmental perturbations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.