Recombinant Schizosaccharomyces pombe Uncharacterized protein C589.06c (SPAC589.06c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipments, as additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPAC589.06c; Uncharacterized protein C589.06c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC589.06c
Target Protein Sequence
MNAQVLNLVAALGVMQYSKKLDFTDPQIVYYARAAYVISNTIIFGVYAIIQARINANNDE TPLVYEEPAPPFSGQSNGKLVTTTVKEYDSEQLQKAKRSTMMGVAIMAFMHLYMGYAQPL VIQSILPLISLFTNNLVSIYIFNKAAEGSLSRPFAPPAGLFGGGNKPAAAVTGTSSNSNN ASAKSDGPTITELNENETEKSS
Uniprot No.

Target Background

Database Links
Protein Families
PHO88 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How should SPAC589.06c be stored and handled for experimental work?

For optimal storage and handling of recombinant SPAC589.06c:

  • Store at -20°C; for extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles

  • Store working aliquots at 4°C for up to one week

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol

The shelf life depends on multiple factors including storage state, buffer ingredients, storage temperature, and the protein's inherent stability. Generally, the liquid form has a shelf life of approximately 6 months at -20°C/-80°C, while the lyophilized form can be stable for up to 12 months at -20°C/-80°C .

How do I predict the cellular localization and topology of SPAC589.06c?

Determining the cellular localization and topology requires both computational prediction and experimental verification:

Computational approaches:

  • Use transmembrane prediction tools (TMHMM, Phobius) to identify membrane-spanning domains

  • Apply SignalP analysis to detect potential N-terminal signal sequences

  • Employ cellular localization predictors (PSORT, TargetP) to generate localization hypotheses

Experimental verification methods:

  • Fluorescent protein tagging: Create C-terminal or internal GFP/mCherry fusions and analyze by confocal microscopy

  • Immunofluorescence: Develop and validate antibodies against SPAC589.06c

  • Subcellular fractionation: Perform differential centrifugation followed by Western blotting

  • Protease protection assays: Map protein orientation in membranes

  • Epitope tagging at predicted loops with accessibility studies

For S. pombe-specific considerations:

  • Use the endogenous promoter to maintain physiological expression levels

  • Consider chromosomal integration of tagged constructs

  • Include co-localization with established organelle markers (Cut11 for nuclear envelope, Cox4 for mitochondria)

  • Verify localization under various growth conditions as distribution may be dynamic

What systematic approach should I follow for initial characterization of SPAC589.06c?

A comprehensive characterization of SPAC589.06c should follow this systematic workflow:

Stage 1: Bioinformatic analysis

  • Sequence homology searches (BLAST, HHpred)

  • Domain prediction and conservation analysis

  • Secondary structure prediction (PSIPRED)

  • 3D structure modeling (AlphaFold2)

Stage 2: Expression pattern analysis

  • RNA-seq data mining from public S. pombe datasets

  • RT-qPCR under different growth conditions and stress responses

  • Promoter-reporter constructs to visualize expression patterns

Stage 3: Genetic characterization

  • Gene deletion using homologous recombination

  • Construction of conditional mutants if essential

  • Tetrad analysis to assess viability

  • Growth phenotyping under various conditions (temperature, nutrients, stressors)

Stage 4: Protein analysis

  • Localization studies using fluorescent protein tagging

  • Interaction studies via immunoprecipitation-mass spectrometry

  • Post-translational modification mapping

Stage 5: Functional assays

  • Phenotypic analysis of deletion/mutation strains

  • Suppressor screens to identify genetic interactions

  • Complementation testing with potential orthologs

This approach allows for efficient resource allocation, beginning with computational predictions and progressing to more resource-intensive experimental work based on initial findings .

How can I design effective knockout or mutation studies for SPAC589.06c?

To effectively disrupt or modify SPAC589.06c function, consider these methodological approaches:

Knockout strategy:

  • Design a deletion cassette:

    • Select an appropriate selection marker (kanMX6, natMX6, hphMX6)

    • Design primers with 80-100bp homology arms flanking SPAC589.06c

    • PCR amplify the deletion cassette

  • Transformation approaches:

    • Lithium acetate method with heat shock

    • Electroporation for higher efficiency

    • Verify integration by diagnostic PCR with primers outside the homology region

  • Phenotypic analysis:

    • Growth assessment in various media conditions

    • Microscopic examination of cellular morphology

    • Stress response testing (temperature, oxidative, osmotic)

    • Cell cycle analysis by flow cytometry or microscopy

Mutation studies:

  • Site-directed mutagenesis:

    • Target conserved residues identified by sequence alignment

    • Consider charged-to-alanine scanning of predicted functional domains

    • Prepare mutations in expression plasmids for complementation testing

  • Domain modifications:

    • Remove or exchange predicted functional domains

    • Design constructs maintaining proper protein folding

  • Validation approaches:

    • Complementation testing with wild-type gene

    • Cross-species complementation with homologs

    • Structure-function relationship analysis

Special considerations for transmembrane proteins like SPAC589.06c include ensuring the knockout doesn't affect neighboring genes and analyzing potential complexes that might be disrupted .

What are the most effective proteomics approaches for identifying SPAC589.06c interaction partners?

For identifying interaction partners of transmembrane proteins like SPAC589.06c, several specialized proteomics approaches can be employed:

Affinity purification with mass spectrometry (AP-MS):

  • Optimize tagging: C-terminal or internal tagging with FLAG, HA, or TAP tags

  • Apply membrane-permeable crosslinkers (DSP, formaldehyde) to capture transient interactions

  • Screen mild detergents (digitonin, CHAPS) to maintain protein complexes

  • Include untagged strains and irrelevant tagged proteins as controls

Proximity-based labeling methods:

  • BioID approach: Fusion of SPAC589.06c with biotin ligase (BirA*) to biotinylate proximal proteins

  • APEX2 system: Peroxidase-based labeling of neighboring proteins

  • Quantitative analysis using SILAC or TMT labeling

Membrane-specific interaction methods:

  • MYTH (Membrane Yeast Two-Hybrid): Specifically designed for membrane protein interactions

  • FRET/BRET analysis for in vivo detection of direct interactions

Data analysis strategy:

  • Filter results using SAINT or similar algorithms to score interaction confidence

  • Integrate with existing S. pombe interactome data

  • Validate key interactions by reciprocal tagging, co-localization, or genetic interactions

Based on findings from S. pombe studies, researchers have successfully identified protein complexes using these methods, including the identification of SPAC6G9.15c as part of a ternary complex with Ell1 and Eaf1, demonstrating the effectiveness of mass spectrometry-based approaches for identifying novel protein associations in fission yeast .

How can evolutionary analysis inform functional hypotheses about SPAC589.06c?

Evolutionary analysis provides critical insights for generating testable hypotheses about SPAC589.06c function:

Ortholog identification and analysis:

  • Perform sensitive homology searches using PSI-BLAST, HHpred, or HMMER

  • Identify orthologs across fungal species and possibly more distant organisms

  • Construct multiple sequence alignments to identify conserved residues

  • Generate phylogenetic trees to understand evolutionary relationships

Synteny analysis:

  • Examine gene neighborhood conservation across related species

  • Identify co-evolved gene clusters that may indicate functional relationships

Selection pressure analysis:

  • Calculate dN/dS ratios to identify sites under positive or purifying selection

  • Map conservation patterns onto predicted structural models

  • Identify rapidly evolving versus conserved regions

Functional prediction from evolutionary patterns:

  • Utilize co-evolution networks to predict protein-protein interactions

  • Apply ancestral sequence reconstruction to understand functional shifts

Integration with experimental approaches:

  • Target highly conserved residues for mutagenesis

  • Test functional complementation across species

  • Design chimeric proteins based on evolutionary insights

S. pombe serves as an excellent model for these approaches as it has well-characterized relationships with other fungal species and shares fundamental biological processes with higher eukaryotes, including humans, particularly in areas like mitochondrial inheritance and gene expression .

How can I integrate transcriptomic and proteomic data to understand SPAC589.06c's role in cellular pathways?

A multi-omics approach provides comprehensive insights into SPAC589.06c function:

Experimental design considerations:

  • Generate consistent experimental conditions across platforms

  • Include wild-type and SPAC589.06c deletion/mutation strains

  • Test multiple conditions relevant to hypothesized function

  • Include appropriate time points to capture dynamic responses

Transcriptomic approaches:

  • RNA-seq to identify differentially expressed genes in mutant strains

  • Time-course analysis to capture regulatory dynamics

  • Co-expression network construction to identify functional modules

Proteomic approaches:

  • Global proteome quantification using TMT or SILAC

  • Phosphoproteomics to identify signaling changes

  • Protein complex analysis through BN-PAGE or crosslinking-MS

Integration methodologies:

  • Correlation analysis between transcript and protein levels

  • Pathway enrichment analysis using tools like GSEA

  • Network construction combining protein-protein interactions and co-expression

  • Causal network inference using algorithms like WGCNA or ARACNE

Visualization and interpretation:

  • Integrated pathway visualization using tools like Cytoscape

  • Enrichment maps to identify functional clusters

  • Temporal trajectory mapping for dynamic processes

This integrated approach has proven effective in S. pombe research, as demonstrated by studies that have successfully mapped transcription factor networks and protein interactions . Such analyses can reveal whether SPAC589.06c functions in specific stress responses, metabolic pathways, or cellular structures.

What advanced techniques should I consider for investigating SPAC589.06c's potential role in stress response or cell cycle regulation?

To investigate SPAC589.06c's role in stress response or cell cycle regulation, implement these sophisticated methodological approaches:

Stress response investigation:

  • Comprehensive phenotypic screening:

    • Subject wild-type and SPAC589.06c deletion strains to multiple stressors:

      • Temperature (heat shock, cold shock)

      • Oxidative stress (H₂O₂, menadione)

      • Cell wall/membrane stress (SDS, calcofluor white)

      • DNA damage (UV, MMS, hydroxyurea)

      • Nutrient limitation (nitrogen, carbon)

    • Measure growth parameters, viability, and morphological changes using high-content screening

  • Multi-level molecular analysis:

    • Perform RNA-seq under stress conditions

    • Monitor protein levels and modifications during stress using tagged constructs

    • Analyze subcellular localization changes upon stress induction

Cell cycle regulation investigation:

  • Cell synchronization and dynamics:

    • Implement nitrogen starvation-release or lactose gradient synchronization

    • Monitor SPAC589.06c levels across cell cycle phases

    • Analyze effects on cell cycle progression using flow cytometry

  • Cell cycle checkpoint analysis:

    • Test sensitivity to checkpoint inhibitors

    • Combine with mutations in known checkpoint genes

    • Analyze activation of checkpoint markers

  • Advanced cytological analysis:

    • Implement 4D microscopy (3D + time) to track cellular dynamics

    • Analyze mitotic structures and events with super-resolution microscopy

  • Genetic network mapping:

    • Synthetic genetic array (SGA) analysis with known cell cycle genes

    • Suppressor/enhancer screening to identify genetic interactions

S. pombe is an excellent model for these studies due to its well-characterized cell cycle and stress response pathways. Recent research has demonstrated the value of comprehensive transcription factor mapping in fission yeast, creating resources that can be leveraged to understand regulatory networks .

What are the common challenges in working with transmembrane proteins like SPAC589.06c, and how can they be overcome?

Working with transmembrane proteins presents several technical challenges that require specialized approaches:

Table 1: Challenges and Solutions for Transmembrane Protein Research

ChallengeSolution ApproachesTechnical Details
Low expression levels- Optimize codon usage
- Use strong inducible promoters
- Test secretion signals
Implement S. pombe-specific codon optimization; consider nmt1 promoter variants for controlled expression
Toxicity to host cells- Use tightly regulated expression systems
- Employ specialized host strains
Use thiamine-repressible promoters; test expression in protease-deficient strains
Protein insolubility- Screen detergent panels
- Use fusion partners (MBP, SUMO)
- Implement nanodiscs
Test detergents (DDM, LDAO, Triton X-100); implement systematic detergent screening
Protein aggregation- Optimize buffer conditions
- Add stabilizing agents
Include glycerol (10-20%), specific lipids, and test pH range 6.0-8.0
Structural analysis difficulties- Try LCP crystallization
- Use Cryo-EM approaches
- Apply crosslinking-MS
Implement fragment-based approaches; consider lipid cubic phase methods
Functional assay development- Develop reporter systems
- Use liposome reconstitution
Create fluorescence-based assays for potential transport or signaling functions

Advanced methodological solutions:

  • Protein engineering approaches:

    • Remove flexible regions that may hinder structural analysis

    • Create fusion proteins with well-behaved soluble proteins

    • Design truncation constructs focusing on specific domains

  • Cutting-edge technologies:

    • Nanobody selection for stabilization and crystallization

    • Lipid nanodisc incorporation for native-like environment

    • Hydrogen-deuterium exchange MS for topology mapping

When working with recombinant SPAC589.06c, research indicates that the protein is typically expressed in E. coli systems and can be effectively purified with an N-terminal 10xHis tag , though optimization may be required for specific experimental applications.

How can I design non-disruptive tags or generate specific antibodies for SPAC589.06c?

Creating detection tools for SPAC589.06c requires careful design to maintain protein function:

Antibody development strategy:

  • Epitope selection:

    • Analyze predicted topology to identify exposed loops

    • Select regions with low conservation to generate specific antibodies

    • Avoid functionally important domains based on conservation analysis

    • Consider multiple epitopes to generate complementary antibodies

  • Validation protocols:

    • Quantitative comparison of signal between wild-type and deletion strains

    • Concentration titration to determine optimal working conditions

    • Cross-reactivity testing with related proteins

    • Testing in multiple applications (Western blot, immunoprecipitation, immunofluorescence)

Tag design considerations:

  • Strategic tag placement:

    • Test multiple positions (N-terminal, C-terminal, internal)

    • Use flexible glycine-serine linkers of varying lengths

    • Base placement on structural predictions

    • Consider the known N-terminal 10xHis tag approach for SPAC589.06c

  • Functional validation of tagged constructs:

    • Genetic complementation of deletion phenotypes

    • Growth rate comparison with wild-type strains

    • Stress response and specific functional assays

    • Subcellular localization confirmation

  • Tag minimization strategies:

    • Use small epitope tags (FLAG, HA, V5) instead of larger protein tags

    • Consider removable tags (TEV protease cleavage sites)

    • Test tandem affinity purification tags for specific applications

  • Advanced tagging approaches:

    • CRISPR/Cas9 genome editing for endogenous tagging

    • Conditional degron tagging for functional validation

    • Split GFP complementation to verify correct folding

Research on S. pombe proteins has successfully employed these approaches to study protein complexes, as demonstrated in the identification and characterization of various protein interactions in fission yeast .

What emerging technologies would be most beneficial for characterizing SPAC589.06c function?

Several cutting-edge technologies show promise for advancing SPAC589.06c research:

Advanced structural biology approaches:

  • Cryo-electron microscopy for membrane protein structures without crystallization

  • Integrative structural biology combining multiple data sources

  • AlphaFold2 and RoseTTAFold AI-based structure prediction specifically optimized for membrane proteins

Next-generation genome editing:

  • CRISPR base editing for precise point mutations without double-strand breaks

  • CRISPR interference/activation for tunable gene expression modulation

  • Perturb-seq combining CRISPR screening with single-cell RNA-seq

Advanced imaging technologies:

  • Super-resolution microscopy (PALM/STORM/STED) for nanoscale localization and dynamics

  • Single-molecule tracking for membrane protein diffusion and interaction studies

  • Correlative light and electron microscopy (CLEM) for combining functional and ultrastructural information

Protein engineering approaches:

  • Optogenetic tools for spatiotemporal control of protein function

  • Chemogenetic systems for specific chemical regulation of activity

  • Split protein complementation for visualizing protein-protein interactions in real-time

Systems-level analysis:

  • Multi-omics data integration for holistic functional characterization

  • Machine learning applications for predicting function from diverse data types

Recent advances in S. pombe research, such as the development of comprehensive transcription factor mapping tools, demonstrate how emerging technologies can be effectively applied to understand protein function in this model organism . The creation of resources like the TFexplorer webtool for S. pombe transcription factors illustrates the value of integrated approaches for characterizing previously uncharacterized proteins.

How can SPAC589.06c research contribute to our broader understanding of S. pombe biology?

Research on SPAC589.06c can advance several areas of S. pombe biology:

Membrane protein biology advancement:

  • Develop optimized protocols for membrane protein characterization

  • Establish new tools for studying transmembrane domain functions

  • Contribute to the growing catalog of characterized membrane proteome components

  • Provide insights into membrane organization and dynamics

Genome annotation improvement:

  • Reduce the number of uncharacterized genes in the S. pombe genome

  • Create methodological pipelines applicable to other uncharacterized proteins

  • Contribute to community resources and databases

  • Enable more complete metabolic and regulatory network reconstruction

Evolutionary insights:

  • Understand conservation patterns among fungi and potentially higher eukaryotes

  • Identify lineage-specific adaptations in membrane proteins

  • Contribute to evolutionary understanding of transmembrane domain architecture

Translational relevance:

  • Potential identification of drug targets if homologs exist in pathogenic fungi

  • Understanding fundamental processes relevant to human disease, particularly given S. pombe's relevance as a model for mitochondrial research

  • Establishing S. pombe as a model for specific membrane-related processes

The systematic characterization of SPAC589.06c would contribute to the growing body of knowledge about S. pombe, which has been established as a fundamental model for research, particularly in areas like mitochondrial gene expression where the machinery is structurally and functionally conserved between fission yeast and humans .

What experimental design principles should guide high-quality research on uncharacterized proteins like SPAC589.06c?

When designing experiments for uncharacterized proteins like SPAC589.06c, apply these research design principles:

Rigorous experimental design framework:

  • Clear research question formulation:

    • Develop specific, testable hypotheses based on preliminary bioinformatic analysis

    • Define the scope of investigation (cellular localization, interaction partners, phenotypic effects)

    • Consider both gain-of-function and loss-of-function approaches

  • Control implementation:

    • Include appropriate negative controls (empty vector, untagged strains)

    • Use positive controls when possible (related characterized proteins)

    • Implement internal controls to verify experimental consistency

  • Variable management:

    • Clearly define independent and dependent variables

    • Control for confounding variables (strain background, growth conditions)

    • Ensure manipulated variables directly address research questions

  • Methodological validation:

    • Validate key reagents and tools before experimental use

    • Use multiple complementary approaches to verify findings

    • Implement quality control steps at each experimental stage

  • Data analysis planning:

    • Pre-determine statistical approaches appropriate for expected data

    • Plan for both hypothesis testing and exploratory data analysis

    • Consider power analysis to determine adequate sample sizes

  • Integration with existing knowledge:

    • Design experiments that build on and extend current understanding

    • Position research questions within relevant theoretical frameworks

    • Consider how findings might contribute to broader biological concepts

Research on experimental design emphasizes the importance of considering the alignment between different experimental components, such as ensuring that data collection addresses all variables stated in hypotheses and that observations align with proposed data collection methods .

The development of a comprehensive S. pombe transcription factor atlas demonstrates how systematic approaches to characterizing uncharacterized proteins can yield valuable insights into regulatory networks and protein function, providing a model for research on proteins like SPAC589.06c.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.