Recombinant Schizosaccharomyces pombe Uncharacterized protein C594.02c (SPCC594.02c)

Shipped with Ice Packs
In Stock

Description

General Information

The protein "Recombinant Schizosaccharomyces pombe Uncharacterized protein C594.02c (SPCC594.02c)" refers to an uncharacterized protein originating from the fission yeast Schizosaccharomyces pombe. S. pombe is a species of yeast widely employed as a model organism in biological research . The "C594.02c" designation is likely a specific identifier within the S. pombe genome, but without further characterization, its precise function remains unknown .

Schizosaccharomyces pombe as a Model Organism

S. pombe holds significance in the study of various cellular processes, including DNA repair, mitotic recombination, and the gut microbiome . As a eukaryotic organism with a relatively small genome, S. pombe is a valuable tool for genetic and proteomic research . Genetic studies of the gut microbiome have identified proteins from S. pombe in stool samples from healthy individuals and those with colorectal cancer, suggesting a potential role in carcinogenesis .

Protein Secretion and Colorectal Cancer

Research indicates that S. pombe secretes proteins that can be identified in the human gut, and the patterns of these secreted proteins differ between healthy individuals and those with colorectal cancer (CRC) .

  • Healthy Individuals: A total of 124 proteins secreted by S. pombe were exclusively found in control samples .

  • CRC Samples: Five proteins found in the CRC samples were successfully mapped to the yeast .

  • Late-Stage CRC: Four proteins were exclusively secreted in the late stage of CRC: DNA repair protein rhp57; SWR1 complex bromodomain subunit bdf1; structural maintenance of chromosomes protein 5; and uncharacterised WD repeat-containing protein C16H5.13 .

  • Early-Stage CRC: The conserved oligomeric Golgi complex subunit 8 was secreted in the early stage of CRC .

Rtf2 and mRNA Splicing

Rtf2, another protein found in S. pombe, plays a role in mRNA splicing . Studies have identified that deletion of rtf2 results in intron retention defects, suggesting its importance in efficient splicing .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
SPCC594.02c; Uncharacterized protein C594.02c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC594.02c
Target Protein Sequence
MAPAVFTSDYWKKYFSNKKKPTVKNTSDIDLLHINRGRQPFDEGLSINEDSFFYRHNIHV PRIVYLIIVACGSFIITGGIEFAIAYGMYKKTETSVRLWRLPDTLSGDAAVTNFVQAIVT YWVESILVQGDLRSGLVKPIYFGWWPENFLLREVLRAKPRYHFKFIVFRWMEWLVFVGLR GLVWSVPLWFLFWPATVGILCAPGRHEGNDYYFNNYPAPQVFKLIFGGGEGFVLTPWIAF LHMYMYGHYLHVAKNQKSLPKTSDLEQQRGTSSSQPSENDANITALPKPEPKMYENSDLT PARTPVTPAPLEKPVNLAPEVVEPTNAAASPLQLNAPKLTDVDDSALAYDPTKVQDGEDR FVHNDVPLENAENPSRFVHSDAPIDMTHTTTVISEAQNLPSTLLPQDGNAVHHDTDAPSL SNVRKSVDSPRVPPSFSDDAVSSFSLVTAPSINNVGGSTAPSVNNQEREYDYDDTSSRSS TLTERPVVH
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Uncharacterized protein C594.02c?

Schizosaccharomyces pombe Uncharacterized protein C594.02c (SPCC594.02c) is a protein with UniProt accession number O74505, found in the fission yeast S. pombe strain 972 / ATCC 24843. It is classified as an uncharacterized protein, meaning its biological function has not yet been fully determined. The protein is available commercially as a recombinant protein with >85% purity as determined by SDS-PAGE, produced in mammalian cell expression systems . Based on genomic analysis, the gene is located on chromosome III of S. pombe .

What are the optimal conditions for storing and handling recombinant SPCC594.02c?

Based on product specifications, the following protocols are recommended for handling recombinant SPCC594.02c:

Storage FormRecommended StorageShelf Life
Liquid-20°C/-80°C6 months
Lyophilized-20°C/-80°C12 months

For reconstitution, briefly centrifuge the vial before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% is recommended for long-term storage at -20°C/-80°C. Working aliquots can be stored at 4°C for up to one week. Repeated freezing and thawing is not recommended as it may compromise protein stability and activity .

How can I clone SPCC594.02c for functional studies in S. pombe?

While the search results don't provide direct cloning information for SPCC594.02c, the following methodology can be extrapolated from similar work with S. pombe genes:

  • Design primers flanking the complete ORF, potentially identifiable through the S. pombe genome database at the Sanger Centre.

  • Use PCR to amplify the gene from S. pombe genomic DNA or a cDNA library. When working with genomic DNA, be aware of potential introns that may need to be accounted for.

  • For expression in S. pombe, consider using vectors like pDblet as described in the genetic tug-of-war (gTOW) method . Vectors employing the nmt1 promoter are commonly used for controlled protein expression in S. pombe .

  • For optimal expression, the sequence can be subcloned into vectors with appropriate selection markers (such as URA3 or LEU2), similar to the approach used for other S. pombe genes .

  • Verify the construct by restriction analysis and sequencing before transformation into S. pombe cells using standard protocols.

What approaches can I use to study protein-protein interactions involving SPCC594.02c?

To investigate protein-protein interactions, consider the following methodologies:

  • Co-immunoprecipitation: Develop tagged versions of SPCC594.02c (similar to GFP fusion approaches described for gTOW vectors) and use antibodies against the tag to pull down protein complexes for analysis.

  • Yeast Two-Hybrid Screening: Implement Y2H assays using SPCC594.02c as bait to screen for interacting partners from an S. pombe cDNA library.

  • Proteomics Analysis: Perform mass spectrometry on immunoprecipitated complexes to identify interacting proteins.

  • Fluorescence Microscopy: Create fluorescent protein fusions to study co-localization with potential interacting partners, using techniques similar to those described for monitoring plasmid copy numbers with GFP in S. pombe .

  • Genetic Interaction Mapping: Screen for synthetic lethal or synthetic rescue interactions between SPCC594.02c and other S. pombe genes.

How might SPCC594.02c be involved in S. pombe cell cycle regulation?

To investigate potential roles in cell cycle regulation, consider the following experimental approaches:

  • Overexpression Studies: Employ the gTOW methodology to determine the upper limit of SPCC594.02c expression that cells can tolerate . This approach has successfully revealed the overexpression limits of various cell cycle regulators in S. pombe.

  • Cell Cycle Synchronization: Analyze expression patterns of SPCC594.02c throughout the cell cycle using synchronized cultures.

  • Localization During Cell Division: Examine whether the protein shows specific localization patterns during cell division, particularly in relation to the predetermined cleavage plane characteristic of S. pombe cytokinesis .

  • Mathematical Modeling: Integrate SPCC594.02c into existing mathematical models of the S. pombe cell cycle to predict its potential impacts, similar to the approach used for known cell cycle regulators .

  • Size Control Analysis: Investigate whether SPCC594.02c affects cell size control mechanisms, potentially interacting with the Pom1 gradient system that coordinates cell size and mitotic entry in S. pombe .

How can I develop a gene deletion strategy for SPCC594.02c to study loss-of-function phenotypes?

For generating deletion mutants of SPCC594.02c, consider this methodological approach:

  • Target Selection: Design deletion constructs that replace the entire ORF or key functional domains with a selection marker.

  • PCR-Based Gene Targeting: Generate PCR products with homology regions flanking the target gene, similar to approaches used for other S. pombe genes like PUS1 .

  • Verification Strategy:

    • PCR verification using primers outside the deletion cassette

    • RT-PCR to confirm absence of transcript

    • Western blotting if antibodies are available

  • Phenotypic Analysis: Systematically examine:

    • Growth under various conditions (temperature, nutrients, stress)

    • Cell morphology and size control

    • Cell cycle progression and cytokinesis

    • Response to DNA damage and replication stress

  • Complementation Testing: Reintroduce the wild-type gene to confirm that observed phenotypes are specifically due to SPCC594.02c deletion.

What bioinformatic approaches would help predict the function of SPCC594.02c?

In the absence of experimental data, consider these computational strategies:

  • Sequence Analysis: Perform protein BLAST searches against characterized proteins in other organisms to identify potential homologs.

  • Domain Prediction: Use tools like PFAM, SMART, or InterPro to identify conserved domains that might suggest function.

  • Structural Prediction: Generate 3D structural models using homology modeling or ab initio prediction methods.

  • Co-expression Analysis: Analyze transcriptomic datasets to identify genes with expression patterns similar to SPCC594.02c.

  • Phylogenetic Analysis: Construct evolutionary trees to understand the relationship between SPCC594.02c and similar proteins in other species, potentially revealing functional conservation.

How can I reconcile contradictory data about SPCC594.02c function?

When facing contradictory results, implement this systematic framework:

Source of ContradictionAnalysis ApproachResolution Strategy
Different experimental conditionsCompare temperature, media, strain backgrounds usedStandardize conditions and repeat experiments
Technical variationsAssess methodology differencesImplement orthogonal validation techniques
Partial vs. complete protein studiesDetermine which protein regions were analyzedConduct domain-specific functional studies
Post-translational modificationsCheck for condition-dependent modificationsAnalyze protein under various cellular states

Key methodological considerations:

  • Conduct side-by-side experiments under identical conditions

  • Implement multiple independent techniques to validate findings

  • Consider context-dependent functions (stress responses, cell cycle phases)

  • Analyze dose-dependent effects that might explain threshold-dependent phenotypes

What statistical approaches are appropriate for analyzing SPCC594.02c expression data?

For robust statistical analysis of expression data:

  • Normalization Methods:

    • For qPCR data: Use reference genes stable in S. pombe (similar to approaches used for measuring plasmid copy numbers)

    • For RNA-Seq: Implement RPKM/FPKM or TPM normalization

  • Statistical Tests:

    • For comparing two conditions: t-test or non-parametric alternatives

    • For multiple conditions: ANOVA followed by appropriate post-hoc tests

    • For time-series data: Repeated measures ANOVA or mixed models

  • Replication Requirements:

    • Minimum of three biological replicates

    • Technical replicates to account for measurement variation

  • Data Visualization:

    • Box plots showing distribution of expression values

    • Time-course plots for temporal expression patterns

    • Heat maps for comparing expression across multiple conditions

  • Correlation Analysis: Pearson or Spearman correlation to identify genes with similar expression patterns that might suggest functional relationships.

How can I integrate SPCC594.02c into mathematical models of S. pombe cellular processes?

To incorporate SPCC594.02c into mathematical models:

  • Parameter Determination: Quantify key parameters including:

    • Protein abundance levels under various conditions

    • Protein half-life and degradation rates

    • Expression kinetics in response to stimuli

  • Model Integration Approaches:

    • Extend existing mathematical models of S. pombe cell cycle to include SPCC594.02c

    • Implement sensitivity analysis to determine critical parameters

    • Use overexpression limits determined by gTOW methodology to constrain model parameters

  • Validation Methods:

    • Compare model predictions with experimental results

    • Test model predictions using targeted experiments

    • Refine model parameters based on experimental feedback

  • Simulation Techniques:

    • Deterministic differential equation-based models for population-level behavior

    • Stochastic simulations for single-cell variability analysis

    • Agent-based models for spatial aspects of protein function

This approach mirrors successful efforts to model S. pombe cell cycle regulation using gTOW data, which effectively reproduced the robustness of cell cycle control mechanisms .

How can I design experiments to determine if SPCC594.02c participates in pseudouridine synthesis pathways?

Given that one of the search results discusses pseudouridine synthase in S. pombe , it's worth investigating whether SPCC594.02c might have a role in this pathway:

  • Sequence Comparison: Analyze sequence similarity between SPCC594.02c and known pseudouridine synthases like spPus1p .

  • Complementation Assays: Test whether SPCC594.02c can complement pseudouridine synthase deficiencies in mutant strains (similar to how spPUS1 complemented the thermosensitive phenotype of S. cerevisiae los1Δ pus1Δ double mutant) .

  • In Vitro Activity Assays: Assess whether purified recombinant SPCC594.02c can catalyze pseudouridine formation in RNA substrates.

  • Genetic Interaction Testing: Create double mutants with known pseudouridine pathway genes to identify potential functional relationships.

  • Structural Analysis: Compare predicted structural elements with known pseudouridine synthase domains to identify potential catalytic sites.

What considerations are important when using plasmid-based expression systems for SPCC594.02c?

When expressing SPCC594.02c from plasmids, consider these methodological details:

  • Vector Selection:

    • For controlled expression levels: Consider pTOWsp vectors developed for S. pombe, which enable monitoring of plasmid copy numbers through GFP expression

    • For promoter options: The nmt1 promoter offers titratable expression in S. pombe

  • Copy Number Verification:

    • Implement real-time PCR methods to quantify plasmid dosage in yeast cells

    • Use flow cytometry to monitor GFP levels as a proxy for plasmid copy number

  • Expression Medium:

    • For maximum expression: Use EMM (Edinburgh Minimal Medium) without selective nutrients

    • Allow sufficient cultivation time (48-72 hours depending on the vector backbone)

  • Stability Considerations:

    • Monitor plasmid retention over multiple generations

    • Assess impact of high copy number on cellular growth and physiology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.