Recombinant Schizosaccharomyces pombe Uncharacterized protein C5D6.07c (SPAC5D6.07c)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe Uncharacterized Protein C5D6.07c (SPAC5D6.07c)

The protein SPAC5D6.07c, also known as Pxa1p, is a PXA domain-containing protein found in the fission yeast Schizosaccharomyces pombe. This protein is unique because it contains only the PXA domain without the PX domain, which is typically associated with vesicular trafficking, protein sorting, and lipid modification in eukaryotic cells . The study of SPAC5D6.07c provides insights into the roles of PXA domains in cellular processes.

Function and Role of SPAC5D6.07c

Research on SPAC5D6.07c has shown that it plays a crucial role in vacuole morphology and protein targeting to the vacuole in S. pombe . Vacuoles are essential organelles involved in various cellular processes, including nutrient storage, waste management, and protein degradation. The involvement of SPAC5D6.07c in these processes highlights its importance in maintaining cellular homeostasis.

3.1. Cellular Processes Involvement

  • Vacuole Morphology: SPAC5D6.07c is involved in maintaining the proper morphology of vacuoles, which is critical for their function in cellular processes .

  • Protein Targeting: It also plays a role in targeting proteins to the vacuole, ensuring that proteins are correctly localized within the cell .

3.2. Genetic Studies

Genetic studies in S. pombe have identified several genes essential for cellular processes, including those involved in DNA repair and cell growth regulation . While SPAC5D6.07c is not directly linked to these processes, its role in vacuolar function suggests it could indirectly influence cellular stress responses and nutrient management.

Comparison with Other Proteins

ProteinDomainFunctionOrganism
SPAC5D6.07cPXAVacuole morphology and protein targetingS. pombe
Rad18SMCDNA repair processesS. pombe
CENP-AHistone H3Centromere determination and cell divisionVarious

Future Research Directions

Further research on SPAC5D6.07c could involve exploring its interactions with other proteins and its role in stress responses. Additionally, studying the conservation of PXA domains across different species could provide insights into their evolutionary significance.

References Hosomi, A., Kawanishi, Y., Tanaka, N., & Takegawa, K. (2008). PX Domain-Containing Protein Pxa1 Is Required for Normal Function and Morphology of Vacuoles in Schizosaccharomyces pombe. Bioscience, Biotechnology, and Biochemistry, 72(2), 706–716. doi: 10.1271/bbb.70666 The contribution of non-essential Schizosaccharomyces pombe genes to fitness in diverse nutrient environments. (2018). Royal Society Open Biology, 8(5), 180015. doi: 10.1098/rsob.180015 Lehmann, A., et al. (2005). Composition and Architecture of the Schizosaccharomyces pombe Rad18 (Smc5-6) Complex. Molecular and Cellular Biology, 25(1), 172–184. doi: 10.1128/MCB.25.1.172-184.2005 SNAP-tag Technologies: Tools to Study Protein Function. (n.d.). New England Biolabs. Decottignies, A., et al. (2003). Essential Genes in Schizosaccharomyces pombe: A Pilot Study. Molecular Biology of the Cell, 14(10), 3971–3983. doi: 10.1091/mbc.E03-04-0231 Zhang, Y., et al. (2007). Isolation of the Schizosaccharomyces pombe Proteasome Subunit Rpn7 and a Structure-Function Study of the Proteasome-COP9-Initiation Factor Domain. Journal of Biological Chemistry, 282(35), 25247–25256. doi: 10.1074/jbc.M703251200 Ye, Y. (2024). Research Goal. National Institute of Diabetes and Digestive and Kidney Diseases. Frontiers | Schizosaccharomyces pombe Grx4, Fep1, and Php4. (2022). Frontiers in Genetics, 13, 1069068. doi: 10.3389/fgene.2022.1069068

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
pxa1; SPAC5D6.07c; PXA domain protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-495
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
pxa1
Target Protein Sequence
MAKLSSLLNPIISKILEIYVYSWYSGISKDALFPSQCEQVGGSIVHELEKRLSRQDAMDL LFYEIPFLLIKHIENTEEAKLRFALPQGQILEIDTIYHSLHPHIALEKEENELVYCRLLV EDILKYLLPATNSKSEIECVILREALAVQIHKSIQVASSPETMYKFIIYLSKAILQPSRR PWKESITTAVRWVWHAFRILLITRGVPYFSTAWFQFYLKLFSQKDNVSSSDLTRWFFFYT LLYPWIALVSAFVAETMTLCCIVTIFYDKNVNRQWKQYILTSVSNMDKGNPSGGSQSTNV TTFRRFSQSSYPRRSNYRRRISTSSKSLYELSPSKFKSIPITSNPPPMLNLSKGSTSVEP TFCETNASVALSTVTSTPVFSTDSSPLSSRTRENLLSLIPSAVSSPTKANTNKSHQRSFS IPKATKDSQTPSENSAATLKQAAIDAYSQIPVIPFFLPSDKLIMLVESEYRNKHIFYSLL NSFTMVMFPELRHTK
Uniprot No.

Target Background

Function
Essential for normal vacuolar morphology and vacuolar protein transport. Also required for endosome-to-Golgi protein transport.
Database Links
Subcellular Location
Endosome membrane; Multi-pass membrane protein.

Q&A

What is currently known about the biological function of SPAC5D6.07c?

While SPAC5D6.07c remains largely uncharacterized, genomic analysis suggests potential roles in cellular processes. Recent studies on non-essential S. pombe genes indicate that it may be involved in nutrient response pathways, potentially related to target of rapamycin (TOR) signaling networks that coordinate cell growth and proliferation with nutrient availability .

How should researchers approach the expression and purification of this recombinant protein?

Based on established recombinant protein expression protocols, researchers should consider the following methodological approach for SPAC5D6.07c expression and purification:

Expression System Selection:

  • E. coli is recommended as the initial expression system due to its ease of use and high yield potential

  • Consider optimized conditions using factorial design: growth until OD600 of 0.8, with 0.1 mM IPTG induction for 4 hours at 25°C in a medium containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose

Purification Strategy:

  • Initial capture using affinity chromatography (dependent on the tag used)

  • Secondary purification via ion exchange chromatography

  • Final polishing step using size exclusion chromatography

Storage Recommendations:

  • Store in Tris-based buffer with 50% glycerol

  • For extended storage, maintain at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

This methodological approach has demonstrated effectiveness in achieving high yields (up to 250 mg/L) of soluble recombinant proteins with approximately 75% homogeneity .

What experimental design approaches optimize expression of SPAC5D6.07c in heterologous systems?

Optimizing expression of the uncharacterized protein SPAC5D6.07c requires a systematic experimental design approach. A factorial design methodology is highly recommended to simultaneously evaluate multiple variables affecting expression.

Table 1: Factorial Design Variables for SPAC5D6.07c Expression Optimization

VariableLow LevelMid LevelHigh Level
Temperature18°C25°C37°C
IPTG Concentration0.1 mM0.5 mM1.0 mM
Induction Time4 hours8 hours16 hours
Media CompositionMinimalStandardRich
Cell Density (OD600)0.60.81.0
pH6.57.07.5
Aeration RateLowMediumHigh
AdditivesNoneGlucoseGlycerol

The expression efficiency should be evaluated through multiple response variables:

  • Total protein yield

  • Soluble protein fraction

  • Functional activity (if assays are available)

  • Purity after initial capture step

Based on previous studies with recombinant proteins in E. coli, the critical factors likely to significantly impact SPAC5D6.07c expression include temperature, induction time, and cell density at induction . For membrane-associated proteins like SPAC5D6.07c (predicted based on sequence), lower temperatures (18-25°C) often favor proper folding and solubility.

Statistical analysis of the factorial design results using ANOVA can identify both main effects and interaction effects between variables, allowing for precise optimization of expression conditions .

How does the fitness contribution of SPAC5D6.07c vary under different nutrient conditions?

Understanding the fitness contribution of SPAC5D6.07c requires systematic evaluation under various nutrient conditions. Based on research with non-essential S. pombe genes, fitness profiling under varied nutrient conditions reveals important functional insights.

Experimental Approach:

  • Generate knockout strains (ΔSPAC5D6.07c)

  • Assess growth in nutrient-rich versus minimal media

  • Evaluate fitness with varying nitrogen sources (ammonium, glutamate, proline)

  • Test growth under TOR signaling inhibition (e.g., using Torin1)

Table 3: Priority Biochemical Assays Based on Sequence Analysis

Predicted FunctionRecommended AssaysExpected Outcomes
Transmembrane TransportReconstitution in liposomes, Transport assaysSubstrate specificity, Kinetics
Signal TransductionPhosphorylation assays, Interaction with TOR componentsRegulatory mechanisms
Metabolic FunctionMetabolite binding assays, Enzymatic activity screensSubstrate identification
Stress ResponseStability assays under varying conditionsConformational changes

For uncharacterized proteins like SPAC5D6.07c, a tiered approach is recommended, starting with broad functional screens followed by focused assays based on initial results. The sequence suggests potential membrane association, making transport or signaling functions plausible hypotheses to test first .

How can researchers effectively investigate the role of SPAC5D6.07c in TOR signaling pathways?

Investigating the potential role of SPAC5D6.07c in TOR signaling requires a multi-faceted approach:

Genetic Interaction Analysis:

  • Generate double mutants with known TOR pathway components

  • Perform synthetic genetic array (SGA) analysis to identify genetic interactions

  • Assess epistatic relationships through phenotypic analysis of double mutants

  • Conduct suppressor/enhancer screens to identify functional connections

Biochemical Pathway Analysis:

  • Monitor changes in TOR activity markers (e.g., phosphorylation of S6K, 4E-BP1) in SPAC5D6.07c mutants

  • Assess sensitivity to TOR inhibitors (rapamycin, Torin1) in wild-type vs. mutant backgrounds

  • Investigate physical interactions between SPAC5D6.07c and TOR complex components

  • Analyze changes in downstream TOR-regulated processes (e.g., autophagy, protein synthesis)

Nutrient Response Integration:

  • Compare transcriptional profiles of SPAC5D6.07c mutants under normal and nutrient-limited conditions

  • Assess localization changes in response to nutrients and TOR inhibition

  • Evaluate metabolic adaptations in mutants under varying nutrient conditions

  • Investigate the impact on amino acid sensing and transport

Research on S. pombe genes has shown that proteins involved in various processes including autophagy, mRNA metabolic processing, and nucleocytoplasmic transport are essential for tolerating reduced TOR signaling . The experimental design should therefore consider these potential functional areas when assessing the role of SPAC5D6.07c.

How should researchers analyze large-scale fitness data to understand SPAC5D6.07c function?

Analyzing large-scale fitness data for SPAC5D6.07c requires sophisticated computational approaches:

Data Processing and Normalization:

  • Apply appropriate normalization methods to account for batch effects

  • Implement robust statistical methods for comparing fitness across conditions

  • Calculate fitness scores relative to wild-type controls

  • Apply false discovery rate corrections for multiple hypothesis testing

Comparative Analysis Approaches:

  • Cluster genes by fitness profiles across conditions

  • Perform principal component analysis to identify major sources of variation

  • Compare SPAC5D6.07c fitness profile with profiles of genes of known function

  • Integrate with existing genetic interaction networks

Table 4: Fitness Data Interpretation Framework

Fitness PatternPotential Functional ImplicationFollow-up Experiments
Sensitive to nitrogen limitationNitrogen metabolism/transport roleNitrogen utilization assays
Sensitive to TOR inhibitionTOR pathway componentTOR signaling analysis
Similar profile to membrane transportersTransport functionTransport assays
Similar profile to stress response genesStress adaptation roleStress response testing

The fitness profile pattern of SPAC5D6.07c can be particularly informative when compared with genes of known function. Research on S. pombe genes has established distinctive patterns for genes involved in specific processes, such as transmembrane transport, transcription, chromatin organization/regulation, and vesicle-mediated transport .

What approaches can reconcile contradictory experimental findings about SPAC5D6.07c?

When faced with contradictory experimental findings about SPAC5D6.07c, researchers should employ systematic reconciliation strategies:

Source of Contradiction Assessment:

  • Evaluate experimental conditions (strain backgrounds, media, temperature)

  • Examine methodological differences (assay sensitivity, detection methods)

  • Consider genetic background effects (suppressor mutations, epigenetic states)

  • Assess protein expression levels and modifications in different studies

Resolution Strategies:

  • Direct Replication: Reproduce contradictory experiments in the same laboratory

  • Methodology Standardization: Develop consistent protocols across research groups

  • Integrative Analysis: Consider multiple lines of evidence weighted by methodological rigor

  • Conditional Function Hypothesis: Test if the protein has context-dependent functions

Meta-analysis Approach:

  • Systematically collect all experimental data on SPAC5D6.07c

  • Assess quality and reliability of each data point

  • Identify patterns that could explain apparent contradictions

  • Develop testable hypotheses to resolve conflicts

For uncharacterized proteins like SPAC5D6.07c, contradictions often arise from context-dependent functions or involvement in multiple cellular processes. Research on non-essential S. pombe genes has shown that many proteins have distinct roles depending on nutrient conditions or cellular stresses , making careful experimental design and comprehensive analysis essential for resolving apparent contradictions.

How can researchers integrate omics data to build a comprehensive functional model of SPAC5D6.07c?

Building a comprehensive functional model of SPAC5D6.07c requires integration of multiple omics datasets:

Multi-omics Data Collection:

  • Transcriptomics: RNA-seq of knockout vs. wild-type under multiple conditions

  • Proteomics: Global protein expression changes and post-translational modifications

  • Interactomics: Protein-protein interaction networks from AP-MS, Y2H, BioID

  • Metabolomics: Metabolite profiles in knockout vs. wild-type cells

  • Phenomics: Systematic phenotypic characterization under diverse conditions

Data Integration Framework:

  • Apply network-based approaches to connect disparate datasets

  • Use machine learning algorithms to identify patterns across datasets

  • Implement Bayesian approaches to incorporate prior knowledge

  • Develop weighted integration methods based on data quality and relevance

Functional Model Development:

  • Create initial models based on strongest multi-omics signals

  • Test model predictions with targeted experiments

  • Refine models based on experimental validation

  • Iterate between prediction and validation

Research on non-essential S. pombe genes has demonstrated the power of integrated approaches for uncovering protein functions, particularly for proteins involved in nutrient sensing and TOR signaling pathways . For SPAC5D6.07c, integration of fitness data under varied nutrient conditions with interactome and transcriptomic data is likely to provide the most comprehensive functional insights.

What are the critical quality control steps for working with recombinant SPAC5D6.07c?

Ensuring high-quality recombinant SPAC5D6.07c requires rigorous quality control at multiple stages:

Expression Quality Control:

  • Verify plasmid sequence before expression

  • Confirm protein expression through Western blotting

  • Monitor expression yield across different batches

  • Assess soluble vs. insoluble fractions

Purification Quality Control:

  • Evaluate purity by SDS-PAGE and/or mass spectrometry

  • Verify protein identity through peptide mapping

  • Test for endotoxin contamination

  • Assess aggregation state through dynamic light scattering (DLS)

Functional Quality Control:

  • Develop activity assays based on predicted function

  • Evaluate thermal stability through differential scanning fluorimetry

  • Assess proper folding through circular dichroism

  • Verify expected interaction partners through pull-down assays

Storage and Stability:

  • Monitor stability in Tris-based buffer with 50% glycerol

  • Assess activity retention after freeze-thaw cycles

  • Evaluate long-term storage stability at -20°C and -80°C

  • Test the impact of different buffer compositions on stability

For membrane-associated proteins like SPAC5D6.07c (based on sequence prediction), additional controls for proper folding are critical. The optimization of expression conditions through factorial design approaches can significantly improve quality and yield, with potential to achieve up to 75% homogeneity .

How can researchers overcome common challenges in structural studies of SPAC5D6.07c?

Structural characterization of SPAC5D6.07c presents several challenges that require strategic approaches:

Challenge: Low Expression Yield

  • Solution: Optimize expression using factorial design methodology

  • Implement codon optimization for the expression host

  • Consider fusion partners to enhance solubility (MBP, SUMO, thioredoxin)

  • Test multiple expression systems (bacterial, yeast, insect, mammalian)

Challenge: Protein Instability

  • Solution: Screen multiple buffer conditions using thermal shift assays

  • Include stabilizing agents (glycerol, specific ions, reducing agents)

  • Consider limited proteolysis to identify stable domains

  • Explore nanobodies or other binding partners for co-crystallization

Challenge: Membrane Association

  • Solution: Utilize detergent screening to identify optimal solubilization conditions

  • Consider lipid nanodiscs for maintaining native-like environment

  • Explore amphipols as alternatives to detergents

  • Implement fusion with crystallization chaperones

Challenge: Conformational Heterogeneity

  • Solution: Implement size exclusion chromatography to isolate homogeneous populations

  • Use crosslinking to capture specific conformational states

  • Consider cryo-EM for capturing multiple conformational states

  • Apply computational approaches to model flexible regions

For uncharacterized proteins like SPAC5D6.07c, an iterative approach is recommended, starting with biophysical characterization of the full-length protein, followed by domain identification and focused structural studies on stable domains. The high-quality recombinant protein preparation, with proper storage in Tris-based buffer with 50% glycerol , provides a solid foundation for subsequent structural investigations.

What collaborative approaches accelerate functional characterization of SPAC5D6.07c?

Accelerating the functional characterization of SPAC5D6.07c requires strategic collaborative approaches:

Interdisciplinary Team Assembly:

  • Geneticists: For knockout generation and genetic interaction studies

  • Biochemists: For protein purification and enzymatic characterization

  • Structural Biologists: For protein structure determination

  • Cell Biologists: For localization and cellular function studies

  • Bioinformaticians: For sequence analysis and data integration

  • Systems Biologists: For network analysis and modeling

Collaborative Research Framework:

  • Establish clear project milestones and deliverables

  • Implement regular data sharing and integration meetings

  • Develop standardized protocols for cross-lab validation

  • Create centralized database for all experimental results

Resource Sharing Strategies:

  • Generate and distribute high-quality antibodies against SPAC5D6.07c

  • Share expression constructs and optimized purification protocols

  • Establish knockout and tagged cell lines for distribution

  • Develop computational models accessible to all collaborators

Integrative Analysis Approaches:

  • Hold regular cross-disciplinary data analysis workshops

  • Implement common data standards and formats

  • Develop integrated visualization tools for multi-dimensional data

  • Establish clear authorship guidelines for collaborative publications

Research on non-essential S. pombe genes has demonstrated that integrative approaches connecting genetic, biochemical, and cellular analyses yield the most comprehensive functional insights . For uncharacterized proteins like SPAC5D6.07c, parallel investigation of multiple aspects (structure, interaction partners, cellular localization, and phenotypic impacts) provides complementary evidence that accelerates functional characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.