Recombinant Schizosaccharomyces pombe Uncharacterized protein C630.04c (SPAC630.04c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
SPAC630.04c; Uncharacterized protein C630.04c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC630.04c
Target Protein Sequence
MGEEISAIDLVMANDQLVSTSDASDIPYDPYSQFWGKVLVLTFGIICVVFVIFMLHHERI KACRTIISAREQQRTQHSIHRRERSSSGASQQFEHHVRQTDCLPLYEPITALNQQYLKTL PTTSTPPPPAIFDENGEFVGDVPSVAGAIERPPSYESLPAPQNDEV
Uniprot No.

Target Background

Database Links
Subcellular Location
Vacuole membrane; Single-pass membrane protein.

Q&A

What is SPAC630.04c and what are its basic structural characteristics?

SPAC630.04c is an uncharacterized protein from the fission yeast Schizosaccharomyces pombe. Current data indicates it is a relatively small protein consisting of 166 amino acids in its full-length form . The protein has been successfully expressed recombinantly with a histidine tag in E. coli expression systems, which facilitates purification through affinity chromatography .

When approaching uncharacterized proteins like SPAC630.04c, researchers should first conduct bioinformatic analyses including sequence homology searches, domain prediction, and secondary structure modeling. Tools such as BLAST, Pfam, InterProScan, and AlphaFold2 can provide initial insights into potential structural features, even without experimental structural data.

What expression patterns does SPAC630.04c show under different growth conditions?

While specific expression data for SPAC630.04c is limited in the available literature, researchers investigating this protein should implement temporal RNA-seq analysis using packages like MultiRNAflow to characterize its expression patterns . This approach enables:

  • Normalization of expression data across multiple conditions

  • Principal component analysis (PCA) to identify major sources of expression variation

  • Hierarchical clustering to identify co-expressed genes

  • Temporal clustering to identify specific expression patterns over time

MultiRNAflow particularly excels at analyzing experimental designs with reference time points (t0) compared to subsequent measurements (t1-tn), which would be valuable for studying SPAC630.04c expression in response to environmental stressors or cell cycle progression .

How is SPAC630.04c conserved across fungal species?

While comprehensive conservation data is not explicitly provided in the search results, researchers should employ comparative genomic approaches to assess SPAC630.04c conservation. Methodologically, this involves:

  • BLAST searches against fungal genome databases

  • Multiple sequence alignment of homologs using tools like MUSCLE or Clustal Omega

  • Phylogenetic analysis to determine evolutionary relationships

  • Domain conservation analysis to identify functionally important regions

This evolutionary analysis can provide crucial insights into the potential functional importance of SPAC630.04c, as regions conserved across species often indicate functional constraints.

What protocols are most effective for purifying recombinant SPAC630.04c?

Based on the available information, SPAC630.04c has been successfully expressed as a recombinant protein with a histidine tag in E. coli . For effective purification, researchers should follow this methodological approach:

  • Transform expression vector containing His-tagged SPAC630.04c into an appropriate E. coli strain

  • Optimize induction conditions (temperature, IPTG concentration, duration)

  • Lyse cells using methods that maintain protein stability

  • Purify using Ni-NTA affinity chromatography with optimized imidazole gradient

  • Further purify using size exclusion chromatography if higher purity is required

For a small protein like SPAC630.04c (166 amino acids), special attention should be paid to potential solubility issues and proper folding in bacterial expression systems.

How can temporal RNA-seq analysis be applied to understand SPAC630.04c function?

For comprehensive functional characterization of SPAC630.04c through transcriptomics, researchers should implement a temporal RNA-seq approach using the MultiRNAflow package . This methodological framework enables:

  • Exploratory (unsupervised) analysis of expression data across multiple conditions and time points

  • Statistical (supervised) analysis of differential expression patterns

  • Functional and Gene Ontology analysis of co-expressed genes

The package specifically supports experimental designs with a reference time point (t0) and subsequent measurements (t1-tn), which is ideal for studying gene expression changes in response to various stimuli . For SPAC630.04c functional characterization, researchers should:

  • Design experiments with multiple time points after relevant treatments

  • Include appropriate biological replicates (minimum 3-4 per condition)

  • Apply DESeq2-based statistical analysis to identify significant expression changes

  • Utilize clustering approaches to identify genes with similar expression patterns

  • Perform GO enrichment analysis to identify biological processes correlated with SPAC630.04c expression

This approach can reveal functional associations even for uncharacterized proteins by establishing "guilt by association" relationships with genes of known function.

What intronic RNA structures might exist in SPAC630.04c and how might they contribute to function?

Recent research indicates that intronic RNA structures in yeast genomes may play functional roles beyond their traditional understanding as splicing intermediates . For SPAC630.04c, researchers should investigate:

  • Whether SPAC630.04c contains introns, and if so, their conservation across fungal species

  • The potential for these introns to form stable RNA structures using computational prediction tools like RNAfold or Mfold

  • Experimental validation of predicted structures through techniques like SHAPE-seq or DMS-MaPseq

  • The persistence of excised introns in the cell using RNA-seq data analysis

Research by Hooks et al. demonstrated that contrary to common belief that excised introns are rapidly degraded, some introns containing RNA structures are maintained intact in cells . In certain cases, ncRNAs can be further processed from these introns, potentially serving regulatory functions .

To experimentally test the functional significance of potential intronic RNA structures in SPAC630.04c, researchers could:

  • Delete the intronic regions containing predicted RNA structures

  • Assess the impact on gene expression and cellular phenotypes

  • Investigate direct associations between the in cis presence of intronic RNA and SPAC630.04c expression

This approach was successfully used to demonstrate that an intronic RNA structure within the GLC7 intron, rather than the intron itself, was responsible for the cell's ability to respond to salt stress .

What computational approaches can predict SPAC630.04c function?

For uncharacterized proteins like SPAC630.04c, computational prediction methods provide valuable insights for guiding experimental work. Researchers should employ a multi-faceted approach:

  • Sequence-based predictions:

    • Profile Hidden Markov Models for distant homology detection

    • Position-Specific Scoring Matrices for motif identification

    • Machine learning approaches trained on sequence features

  • Structure-based predictions:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Structure comparison against proteins of known function

    • Binding site prediction for potential ligands or interaction partners

  • Network-based predictions:

    • Co-expression network analysis using RNA-seq data

    • Protein-protein interaction predictions

    • Genomic context analysis (gene neighborhood, gene fusion events)

  • Evolutionary analysis:

    • Phylogenetic profiling to identify co-evolved genes

    • Selection pressure analysis to identify functionally constrained regions

The integration of multiple prediction approaches increases confidence in functional hypotheses and provides a framework for targeted experimental validation.

How can CRISPR-Cas9 be utilized for functional characterization of SPAC630.04c?

CRISPR-Cas9 technology offers powerful approaches for functional characterization of uncharacterized proteins like SPAC630.04c. Researchers should consider these methodological strategies:

  • Gene knockout studies:

    • Complete deletion of SPAC630.04c to assess null phenotype

    • Analysis of growth rates under various conditions

    • Phenotypic screening for sensitivities to different stressors

  • Domain-specific modifications:

    • Introduction of point mutations in predicted functional domains

    • Creation of truncated versions to assess domain-specific functions

    • Insertion of epitope tags for localization and interaction studies

  • Promoter modifications:

    • Creation of controllable expression systems (e.g., tetracycline-inducible)

    • Replacement with fluorescent reporter constructs to monitor expression

    • Installation of degron tags for temporal control of protein levels

  • Base editing approaches:

    • Introduction of specific amino acid changes without double-strand breaks

    • Systematic mutagenesis of conserved residues

    • Creation of conditional alleles

When applying CRISPR-Cas9 to S. pombe, researchers should be aware of the lower homologous recombination efficiency compared to S. cerevisiae and optimize their protocols accordingly.

What RNA-seq experimental design is optimal for studying SPAC630.04c expression patterns?

For comprehensive characterization of SPAC630.04c expression patterns, researchers should implement a temporal RNA-seq design with multiple biological conditions. Based on the MultiRNAflow framework, the optimal experimental design would include :

  • Multiple biological conditions:

    • Wild-type S. pombe

    • SPAC630.04c deletion strain

    • Strains with modified SPAC630.04c (e.g., overexpression, tagged versions)

    • Different environmental conditions (nutritional status, stress conditions)

  • Multiple time points:

    • Reference time point (t0) representing basal state

    • Several subsequent time points (t1-tn) after relevant treatment or stimulus

    • Time intervals appropriate for the expected response dynamics

  • Sufficient biological replicates:

    • Minimum of 3-4 replicates per condition and time point

    • Consistency in sample preparation and sequencing depth

The following table illustrates an example experimental design:

Biological ConditionTime Points (hours)ReplicatesTotal Samples
Wild-type0, 4, 8, 12, 16, 20424
SPAC630.04c deletion0, 4, 8, 12, 16, 20424
SPAC630.04c overexp.0, 4, 8, 12, 16, 20424
Osmotic stress0, 4, 8, 12, 16, 20424

This design enables comprehensive analysis of SPAC630.04c's role in various cellular contexts and temporal responses .

What analytical pipeline should be used for integrating multiple data types in SPAC630.04c research?

For integrative analysis of SPAC630.04c, researchers should implement a comprehensive pipeline combining multiple data types:

  • Transcriptomics analysis:

    • RNA-seq data preprocessing with tools like MultiRNAflow

    • Normalization of count data

    • Differential expression analysis with DESeq2

    • Temporal clustering to identify expression patterns

  • Proteomics integration:

    • Mass spectrometry data for protein abundance

    • Post-translational modification analysis

    • Correlation of protein and mRNA levels

  • Structural biology approaches:

    • Crystallography or cryo-EM for structural determination

    • Computational modeling for structure prediction

    • Structure-function relationship analysis

  • Interaction network analysis:

    • Yeast two-hybrid or affinity purification-mass spectrometry

    • Co-immunoprecipitation for validation of key interactions

    • Network visualization and pathway enrichment

The integration of these diverse data types requires:

  • Standardization of identifiers across platforms

  • Normalization methods appropriate for each data type

  • Statistical approaches for multi-omics integration

  • Visualization tools for complex data interpretation

How should researchers interpret contradictory findings in SPAC630.04c function studies?

When confronted with contradictory findings regarding SPAC630.04c function, researchers should implement a systematic approach to reconciliation:

  • Methodological assessment:

    • Compare experimental conditions between studies

    • Evaluate strain backgrounds and genetic modifications

    • Assess technical approaches (knockout vs. knockdown, tagging strategies)

    • Consider statistical power and reproducibility metrics

  • Context-dependent function analysis:

    • Evaluate environmental conditions in different studies

    • Consider cell cycle or developmental stage differences

    • Assess growth media compositions and their potential impact

    • Examine genetic background effects and potential suppressors

  • Multifaceted function hypothesis:

    • Consider that SPAC630.04c may have multiple distinct functions

    • Evaluate possibility of condition-specific roles

    • Assess potential moonlighting functions in different cellular compartments

    • Examine protein isoforms or post-translational modifications

  • Resolution strategies:

    • Design experiments that directly test conflicting hypotheses

    • Implement orthogonal approaches to validate key findings

    • Collaborate with labs reporting contradictory results

    • Consider genetic interaction studies to map functional relationships

This structured approach enables researchers to navigate the complexity often encountered in functional studies of uncharacterized proteins.

What statistical approaches are most appropriate for analyzing SPAC630.04c expression data across multiple conditions?

For robust statistical analysis of SPAC630.04c expression across multiple conditions and time points, researchers should implement:

  • Differential expression analysis:

    • DESeq2-based approaches as implemented in MultiRNAflow

    • Model design incorporating both condition and time factors

    • Appropriate contrasts to test specific hypotheses

    • Multiple testing correction for reliable significance assessment

  • Time series analysis:

    • Temporal clustering with soft clustering algorithms (e.g., Mfuzz)

    • Time-course differential expression models

    • Autocorrelation analysis for periodic expression patterns

    • Change point detection for identifying expression transitions

  • Multi-factor analysis:

    • ANOVA-like designs for multiple experimental factors

    • Mixed-effects models for handling complex experimental designs

    • Interaction term analysis for condition-specific temporal responses

    • Post-hoc testing with appropriate correction methods

  • Visualization and interpretation:

    • PCA analysis for dimension reduction and pattern identification

    • Hierarchical clustering for identifying co-expressed genes

    • Volcano plots and MA plots for visualizing differential expression

    • Heatmaps for comprehensive expression pattern visualization

The MultiRNAflow package specifically supports these analytical approaches for complex experimental designs with multiple conditions and time points .

What emerging technologies could advance understanding of SPAC630.04c function?

Several cutting-edge technologies show promise for elucidating the function of uncharacterized proteins like SPAC630.04c:

  • Spatial transcriptomics:

    • Mapping SPAC630.04c expression within cellular compartments

    • Correlating localization with potential function

    • Identifying co-localized transcripts for functional association

  • Single-cell RNA-seq adaptations for yeast:

    • Characterizing cell-to-cell variability in SPAC630.04c expression

    • Identifying subpopulations with distinct expression patterns

    • Correlating with cell cycle or other cellular states

  • Long-read sequencing:

    • Identifying potential isoforms or alternative splicing events

    • Detecting post-transcriptional modifications

    • Characterizing the full-length transcript structure

  • Proximity labeling proteomics:

    • BioID or APEX2 fusions to identify proximal proteins in vivo

    • Spatially-resolved interaction networks

    • Temporal dynamics of protein-protein interactions

  • Cryo-electron tomography:

    • Visualizing SPAC630.04c in its native cellular context

    • Identifying structural features in the cellular environment

    • Correlating localization with potential functions

These technologies, when applied systematically to SPAC630.04c research, could provide unprecedented insights into its biological role and functional mechanisms.

How might intronic RNA structures in SPAC630.04c contribute to its regulation?

Recent research has revealed that intronic RNA structures can play significant functional roles beyond serving as splicing intermediates . For SPAC630.04c, researchers should investigate:

  • Potential regulatory mechanisms:

    • Intronic structures affecting splicing efficiency

    • Excised introns acting as independent functional ncRNAs

    • Structures influencing mRNA stability or translation

    • Interaction with RNA-binding proteins for regulatory functions

  • Experimental approaches:

    • RNA structure prediction and validation experiments

    • Analysis of intron retention under various conditions

    • Assessment of excised intron stability and potential processing

    • CRISPR-based deletion of specific intronic structures

  • Functional significance:

    • Correlation between intronic structure conservation and function

    • Stress-responsive regulation mediated by intronic elements

    • Cellular phenotypes associated with intronic structure disruption

Studies on other yeast genes have demonstrated that intronic RNA structures can mediate responses to environmental stress, as in the case of GLC7 where an intronic RNA structure, rather than the intron itself, was responsible for salt stress response . Similar mechanisms might exist for SPAC630.04c, particularly if its expression patterns show condition-specific regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.