Recombinant Schizosaccharomyces pombe Uncharacterized protein C630.12 (SPAC630.12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPAC630.12; Uncharacterized protein C630.12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-422
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC630.12
Target Protein Sequence
EKIIHTRPHKKCDWRSWEQWESTGNPVRIALVADPQLVDDLTYDYPRPLIGIVKWISDQF LRRHWRYLHKSLKPDITFIMGDLMDTGREFATEEFKKDYFRMMNVLDPKFTNKLEIYPGN HDIGFGNHAIVKDIQRFESLFGPTSRSIDVGNHTLVIVDGIRLSNNVNPQVYQPARDFLK SFETNKDNSRPRILLSHVPLFRPAINSCGELREKDDVIKYGLGYQYQNLLLPELSESILK AVEPIAAFAGDDHDYCEVVHNYQVDTREAATTEYNVKAFSMTSGILYPGYQLLSLNYPYD NPKADQKSSYQTKLCILPNQIQIYVWYGASISIFFALILLRTAIFFFGTDRYSLPLYKTH ARRFSLSTTIHLFKKIVRITLSTFISYTWIPFLLFIFLNIFII
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant SPAC630.12 protein?

For optimal stability and activity retention:

  • Store at -20°C for regular use, or -80°C for extended storage

  • The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized for stability

  • Avoid repeated freeze-thaw cycles, as this can lead to protein degradation and loss of activity

  • Working aliquots can be stored at 4°C for up to one week

  • For reconstitution of lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage

What expression systems are suitable for producing recombinant SPAC630.12?

Multiple expression systems have been utilized for producing recombinant SPAC630.12, each with distinct advantages:

Expression SystemAdvantagesConsiderationsApplications
E. coliHigh yield, cost-effective, rapid expressionMay lack post-translational modificationsStructural studies, antibody production
YeastNative-like post-translational modifications, proper foldingModerate yieldFunctional assays
Mammalian cellsMost authentic post-translational modificationsHigher cost, longer production timeInteraction studies, functional characterization
Insect cellsHigh expression of complex proteinsIntermediate costStructural biology, enzymatic assays

For researchers seeking to optimize expression, it is recommended to conduct pilot studies across different systems. In published studies, E. coli has been successfully used for the expression of many S. pombe proteins, including the related Translin protein, which was expressed and purified for biochemical characterization .

How can I design immunodetection experiments for SPAC630.12?

For effective immunodetection of SPAC630.12:

  • Antibody Selection: Polyclonal antibodies against SPAC630.12 are available (e.g., CSB-PA890850XA01SXV) that have been tested in ELISA and Western blot applications .

  • Western Blot Protocol:

    • Use antigen-affinity purified antibodies raised against recombinant SPAC630.12

    • Typical dilution ranges from 1:500 to 1:2000 in 5% BSA

    • Visualize using appropriate secondary antibodies conjugated to HRP, AP, or fluorescent dyes

    • Expected molecular weight is approximately 23 kDa for the endogenous protein and 29 kDa for His-tagged recombinant versions (note this discrepancy as observed in previous studies)

  • Controls:

    • Positive control: Extracts from wild-type S. pombe cells

    • Negative control: Extracts from S. pombe strains with SPAC630.12 gene deletion

    • Recombinant protein as reference standard

As demonstrated in studies of related S. pombe proteins, immunoprecipitation followed by SDS-PAGE and mass spectrometry can provide additional validation of protein identity and interactions .

What approaches can be used to investigate the function of the uncharacterized SPAC630.12 protein?

A comprehensive functional characterization strategy includes:

  • Bioinformatic Analysis:

    • Sequence homology comparison across species

    • Domain prediction and structural modeling

    • Protein-protein interaction network prediction

  • Gene Deletion and Phenotypic Analysis:

    • Create knockout strains using CRISPR-Cas9 or homologous recombination

    • Analyze growth under various stress conditions (temperature, nutrients, oxidative stress)

    • Examine cell morphology, cell cycle progression, and meiotic efficiency

    • Based on studies of other S. pombe uncharacterized proteins, deletion strains may show subtle phenotypes that are only evident under specific conditions

  • Protein Localization:

    • Generate GFP or other fluorescent protein fusions

    • Perform immunofluorescence microscopy with specific antibodies

    • Conduct subcellular fractionation followed by Western blotting

  • Protein-Protein Interaction Studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity-dependent biotin labeling (BioID or TurboID)

    • Similar approaches have successfully identified interaction partners for other S. pombe proteins, such as Translin and TRAX

  • Cross-Species Network Analysis:

    • Integrate data from multiple species to identify conserved interactions

    • Apply methods like co-inertia analysis (CIA) to compare expression patterns across species

How can I integrate SPAC630.12 into cross-species gene regulatory network analyses?

For integrating SPAC630.12 into cross-species regulatory networks:

  • Generate co-expression data through RNA-seq or microarray experiments under various conditions

  • Apply computational approaches for cross-species network inference:

    • Co-inertia analysis (CIA) to project datasets from different species into a common space

    • Hungarian algorithm matching to optimize gene affiliations

    • K-means clustering to identify functionally related gene groups

    • Back-transformation to construct species-specific sub-networks

  • Validate predicted interactions using experimental approaches:

    • ChIP-seq to identify DNA binding sites

    • RNA-seq after gene perturbation to identify downstream effects

    • Direct protein-protein interaction assays

In a study applying cross-species network analysis to S. cerevisiae and S. pombe data, researchers identified conserved regulatory modules across these distantly related yeast species, demonstrating the power of this approach .

The common network derived from both species showed more significant network motifs than networks constructed from single-species data, as shown in this table of motif significance:

Motif TypeCommon Network p-valueSingle S. cerevisiae p-valueSingle S. pombe p-value
Feed-forward loop0.00240.01780.0412
Bi-fan0.00110.00980.0267
SIM0.00080.01130.0183

Source: Adapted from cross-species common gene regulatory network inference study

What controls should be included when studying SPAC630.12 in S. pombe?

A robust experimental design should include the following controls:

  • Genetic Controls:

    • Wild-type S. pombe strain (e.g., 972/ATCC 24843)

    • SPAC630.12 deletion strain (Δspac630.12)

    • Complementation strain (Δspac630.12 + spac630.12)

    • Similar deletion strains of functionally related genes for comparison

  • Expression Controls:

    • Empty vector controls for recombinant expression

    • Housekeeping gene controls for normalization in qRT-PCR (e.g., act1, cdc2)

    • Unrelated protein controls with similar size/tags for Western blots

  • Experimental Condition Controls:

    • Time-course sampling to capture dynamic changes

    • Different growth phases (logarithmic, stationary)

    • Various stress conditions (temperature shifts, nutrient limitation, oxidative stress)

  • Technical Controls:

    • Biological replicates (minimum n=3)

    • Technical replicates for each measurement

    • Randomization of sample processing order

    • Blinding for subjective measurements

These control strategies are based on established approaches in S. pombe research, as demonstrated in studies of meiosis and DNA recombination .

How can I design experiments to investigate potential roles of SPAC630.12 in meiosis?

Given S. pombe's value as a model organism for meiosis research , investigating SPAC630.12's role in this process requires:

  • Synchronous Meiosis Induction System:

    • Use temperature-sensitive pat1-114 mutation for highly synchronous meiotic induction

    • Monitor standard meiotic markers (e.g., expression of mei2, rec8)

    • Compare wild-type with Δspac630.12 strains

  • Key Meiotic Events to Monitor:

    • DNA replication (flow cytometry)

    • Chromosome pairing (fluorescence microscopy)

    • Recombination initiation (Rec12/Spo11 ChIP)

    • Double-strand break formation (pulse-field gel electrophoresis)

    • Joint molecule formation (2D gel electrophoresis)

    • Spore formation and viability

  • Molecular Techniques:

    • ChIP-seq to identify binding sites during meiotic progression

    • RNA-seq for transcriptome analysis at different meiotic time points

    • Co-immunoprecipitation to identify interaction partners specific to meiosis

    • Live-cell imaging with fluorescently tagged proteins

  • Analysis Framework:

    • Quantitative analysis of timing differences in key meiotic events

    • Statistical comparison of recombination frequencies

    • Assessment of chromosome segregation fidelity

This experimental framework is based on established approaches in S. pombe meiosis research, where nearly synchronous meiosis can be induced and monitored at the molecular level .

How can I resolve inconsistent results when working with recombinant SPAC630.12?

When encountering inconsistent results with recombinant SPAC630.12:

  • Protein Quality Assessment:

    • Verify protein integrity by SDS-PAGE

    • Confirm identity by Western blot or mass spectrometry

    • Check for proper folding using circular dichroism

    • Assess batch-to-batch variation through activity assays

  • Common Issues and Solutions:

IssuePossible CausesSolutions
Low protein yieldSuboptimal codon usage, protein toxicityOptimize codon usage, use different host strains, reduce induction temperature
Protein inactivityImproper folding, missing cofactorsTest different buffer conditions, add potential cofactors, use alternative tags
DegradationProteolysis during purificationAdd protease inhibitors, reduce purification time, optimize storage conditions
AggregationHydrophobic interactions, improper foldingAdd stabilizing agents, optimize buffer composition, reduce protein concentration
Inconsistent bindingPost-translational modificationsUse expression systems that provide appropriate modifications, test different binding conditions
  • Experimental Design Refinement:

    • Implement more stringent controls

    • Increase sample size and replication

    • Standardize protocols and reagents

    • Use internal standards for quantification

How can protein-structure prediction aid in generating hypotheses about SPAC630.12 function?

In the absence of experimental structures, computational prediction can guide functional hypotheses:

  • Structure Prediction Approaches:

    • Homology modeling based on related proteins

    • Ab initio modeling using tools like AlphaFold2 or RoseTTAFold

    • Domain recognition and threading

    • Molecular dynamics simulations to explore conformational flexibility

  • Functional Inference from Structure:

    • Identify potential binding pockets and active sites

    • Recognize structural motifs associated with specific functions

    • Predict protein-protein interaction interfaces

    • Assess membrane association potential based on hydrophobicity patterns

  • Experimental Validation of Predictions:

    • Site-directed mutagenesis of predicted functional residues

    • Targeted biochemical assays based on predicted functions

    • In silico screening for potential binding partners or ligands

    • Structure-based design of inhibitors or activators

  • Integration with Experimental Data:

    • Use structural models to interpret results from deletion or mutation studies

    • Refine models based on experimental constraints (e.g., crosslinking data)

    • Guide the design of truncated constructs for expression and functional studies

This approach has proven valuable for other uncharacterized proteins, where structure-based predictions have led to the discovery of novel functions and guided subsequent experimental validation.

How might studying SPAC630.12 contribute to our understanding of evolutionary conservation in cellular processes?

Investigating SPAC630.12 in an evolutionary context:

  • Comparative Genomics:

    • Identify homologs across fungal species and beyond

    • Analyze sequence conservation patterns to identify functional domains

    • Examine synteny and gene neighborhood conservation

    • Compare with related proteins in S. cerevisiae to understand divergence in function

  • Functional Conservation Analysis:

    • Conduct complementation studies across species

    • Compare phenotypes of deletion mutants in different organisms

    • Analyze cross-species protein-protein interaction networks

    • Examine conservation of expression patterns in response to environmental stimuli

  • Evolutionary Implications:

    • Assess selection pressure on different protein domains

    • Investigate potential cases of neo-functionalization or sub-functionalization

    • Understand the evolution of protein complexes and interaction networks

    • Identify lineage-specific adaptations in protein function

Studies using cross-species network analysis between S. cerevisiae and S. pombe have demonstrated that despite approximately 500 million years of evolutionary divergence, conserved regulatory modules can be identified that maintain similar functions . The integration of data from these distantly related yeasts has proven valuable for understanding core conserved processes while highlighting species-specific adaptations.

What are the challenges and solutions in studying membrane-associated properties of SPAC630.12?

The C-terminal region of SPAC630.12 contains hydrophobic sequences suggestive of potential membrane association . Investigating this property presents specific challenges:

  • Expression and Purification Challenges:

    • Membrane proteins often have low expression levels

    • Maintaining proper folding during solubilization is difficult

    • Purification may require detergents that affect protein function

    Solutions:

    • Use specialized expression systems (e.g., cell-free systems with lipid nanodiscs)

    • Test different detergents and solubilization conditions

    • Consider native membrane extraction methods

  • Structural Analysis Challenges:

    • Traditional structural biology methods are challenging for membrane proteins

    • Detergents may alter native conformation

    • Crystallization is often difficult

    Solutions:

    • Use cryo-electron microscopy for structure determination

    • Apply solid-state NMR for membrane-embedded proteins

    • Utilize molecular dynamics simulations to model membrane interactions

  • Functional Analysis Challenges:

    • Difficulty in assessing activity in artificial environments

    • Membrane composition affects protein behavior

    • Reconstitution may not fully recapitulate native environment

    Solutions:

    • Use liposome reconstitution with defined lipid composition

    • Apply fluorescence-based assays to monitor membrane integration

    • Develop cell-based assays that preserve membrane context

  • Localization Studies:

    • Fluorescent tags may interfere with membrane targeting

    • Fixation for microscopy can alter membrane structures

    Solutions:

    • Use small epitope tags or split fluorescent proteins

    • Apply live-cell imaging techniques

    • Use correlative light and electron microscopy (CLEM)

These approaches have been successfully applied to other membrane proteins in S. pombe and could be adapted for studying the potential membrane-associated functions of SPAC630.12.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.