Recombinant Schizosaccharomyces pombe Uncharacterized protein C688.12c (SPAC688.12c)

Shipped with Ice Packs
In Stock

Description

Basic Characteristics and Protein Overview

SPAC688.12c is encoded by the SPAC688.12c gene in S. pombe and spans 167 amino acids (full-length) . Key features include:

  • Gene Name/ID: SPAC688.12c (ORF name)

  • Alternative Names: Sequence orphan, Uncharacterized protein C688.12c

  • UniProt ID: Q9P6L4

  • Mass: Estimated at ~18.6 kDa (calculated from sequence)

The protein lacks experimentally validated functional annotations, though bioinformatics tools suggest potential roles in cellular processes requiring protein-protein interactions or enzymatic activities.

Recombinant Production and Host Systems

SPAC688.12c is commercially produced using diverse expression systems, optimized for research applications:

Host SystemTagProtein LengthPuritySource
E. coliHis-TagFull-length (1–167)≥85% (SDS-PAGE)Creative BioMart
E. coli/Yeast/BaculovirusVariablePartial≥85% (SDS-PAGE)MyBioSource
Yeast (e.g., S. pombe)GST (optional)Full-lengthNative conditionsPubMed

Key Notes:

  • Host Choice: E. coli is preferred for high-yield production, while S. pombe or mammalian systems enable post-translational modifications (e.g., phosphorylation) .

  • Purification: Affinity chromatography (e.g., His-tag or GST-tag) ensures high purity .

Genetic Interactions

SPAC688.12c exhibits a negative genetic interaction with RGA3 (SPAC29A4.11), a Rho-type GTPase-activating protein. This interaction was identified via an Epistasis MiniArray Profile (E-MAP) study:

  • Score: -2.327 (below the -2.3 threshold for synthetic sick/lethal interactions) .

  • Phenotype: Reduced colony size in double mutants, suggesting functional redundancy or compensatory pathways .

Protein-DNA Interactions

While SPAC688.12c itself is not directly linked to DNA-binding, studies on S. pombe pre-replication complexes (pre-RCs) highlight the importance of ORC (origin recognition complex) interactions with DNA. Though SPAC688.12c is not part of the pre-RC, its genetic interaction with RGA3 may indirectly influence cellular processes like cell cycle regulation or stress response .

Applications in Research

SPAC688.12c is utilized in:

  1. Antibody Development: Rabbit polyclonal antibodies (IgG isotype) are available for ELISA and Western blot detection .

  2. Protein Interaction Studies: Recombinant SPAC688.12c is used to identify binding partners via pull-down assays or yeast two-hybrid systems .

  3. Structural Analysis: Full-length and partial recombinant proteins enable crystallization or NMR studies to resolve its 3D structure .

Unresolved Questions

  1. Functional Annotation: No enzymatic activity or biochemical role has been assigned.

  2. Subcellular Localization: Intracellular targeting (e.g., nucleus, cytoplasm) remains uncharacterized.

Prioritized Research Areas

  1. Interaction Mapping: Systematic screening for binding partners using SPAC688.12c as bait.

  2. Structural Biology: X-ray crystallography or cryo-EM to elucidate conformational dynamics.

  3. Knockout Phenotyping: Deletion studies in S. pombe to assess viability and phenotypic changes .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, customers may specify a preferred tag type, and we will prioritize its development.
Synonyms
SPAC688.12c; Uncharacterized protein C688.12c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC688.12c
Target Protein Sequence
MSEEESPYQLTKTFSNPKNNKIGLAIFLIGAFINLIHIYKPKGPSNNPTKRNYHISFGPP GKIRWFPLGIRKEVRSNVSGREIIIKMIITFILVQTTLITLDLYVFGATGLGLILSWKLF EVACANPEDEALLAERKQRLKEQREKKEQKKEQKKEKKTERRKKKKL
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the basic structure of SPAC688.12C?

SPAC688.12C is an uncharacterized protein from the fission yeast Schizosaccharomyces pombe consisting of 167 amino acids in its full-length form . While the three-dimensional structure has not been fully characterized, researchers can employ several methods to predict structural elements:

  • Use bioinformatics tools such as PSIPRED, JPred, or SWISS-MODEL to predict secondary structure elements.

  • Apply disorder prediction algorithms like PONDR or IUPred to identify potentially unstructured regions.

  • Perform circular dichroism (CD) spectroscopy on purified recombinant protein to estimate secondary structure content.

  • Consider small-angle X-ray scattering (SAXS) for low-resolution structural information.

The protein can be recombinantly expressed with a His-tag to facilitate purification and subsequent structural studies .

What is the genomic context of SPAC688.12C in S. pombe?

The SPAC688.12C gene exists within the S. pombe genome, which has several notable characteristics:

To analyze the genomic context of SPAC688.12C specifically:

  • Examine flanking regions for regulatory elements using tools like MEME or FIMO

  • Identify nearby genes that might be functionally related

  • Search for conserved promoter elements that could indicate co-regulation with other genes

  • Analyze chromosome positioning relative to important features such as centromeres or telomeres, which may affect expression patterns

What expression systems are most effective for SPAC688.12C?

Expression SystemAdvantagesLimitationsBest Use Case
E. coli (BL21(DE3))High yield, cost-effective, rapid growthLimited post-translational modificationsInitial characterization, structural studies
S. pombeNative post-translational modifications, native foldingLower yield, more complex cultureFunctional studies requiring authentic modifications
Insect cellsGood post-translational modifications, high yieldMore expensive, longer timelineProteins requiring complex folding or modifications
Cell-free systemsRapid, avoids toxicity issuesLower yield, expensiveProteins toxic to host cells

For optimal E. coli expression:

  • Test multiple induction temperatures (16°C, 25°C, 37°C)

  • Vary IPTG concentrations (0.1-1.0 mM)

  • Consider specialized strains for rare codon optimization if needed

  • Test solubility enhancement tags (e.g., MBP, SUMO) if the protein aggregates

What purification strategies yield highest purity for functional studies?

Based on the available information, SPAC688.12C can be produced as a His-tagged recombinant protein , suggesting the following purification workflow:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Use gradient elution with imidazole (20-250 mM)

    • Include low concentrations of reducing agents (1-5 mM DTT or β-mercaptoethanol) if the protein contains cysteines

  • Secondary Purification: Size exclusion chromatography

    • Separate monomeric protein from aggregates and contaminants

    • Simultaneously perform buffer exchange to remove imidazole

  • Optional Tertiary Step: Ion exchange chromatography

    • Based on the protein's theoretical isoelectric point

    • Use either anion or cation exchange depending on buffer pH

  • Quality Control:

    • SDS-PAGE with Coomassie staining (>95% purity)

    • Western blot with anti-His antibodies

    • Mass spectrometry to confirm identity and integrity

For functional studies, evaluate protein activity after each purification step to ensure purification conditions do not compromise function.

What strategies can identify the function of uncharacterized SPAC688.12C?

To determine the function of this uncharacterized protein, researchers should employ a multi-faceted approach:

  • Bioinformatic Analysis:

    • Sequence homology searches against characterized proteins

    • Domain and motif identification using InterPro, SMART, or Pfam

    • Structural prediction to identify potential functional sites

  • Gene Deletion/Knockout Studies:

    • Create SPAC688.12C deletion strains using CRISPR-Cas9 gene editing

    • Analyze phenotypes under various growth conditions

    • Perform competitive growth assays against wild-type strains

  • Localization Studies:

    • Generate GFP-tagged versions of SPAC688.12C

    • Perform fluorescence microscopy under different conditions

    • Co-localize with organelle markers to determine subcellular distribution

  • Interactome Analysis:

    • Perform pull-down assays with the His-tagged protein

    • Use yeast two-hybrid screening

    • Conduct proximity labeling experiments (BioID or APEX)

    • Apply mass spectrometry to identify binding partners

  • Transcriptional Profiling:

    • Compare wild-type and knockout strains using RNA-seq

    • Identify pathways affected by SPAC688.12C absence

How should one investigate if SPAC688.12C is involved in stress response pathways?

Given that S. pombe has well-characterized stress response mechanisms , the following protocol would be appropriate:

  • Translational Profiling:

    • Expose wild-type and SPAC688.12C-knockout S. pombe to various stressors (heat, oxidative stress, DNA damage)

    • Perform polysome profiling to analyze translational regulation

    • Calculate translational scores before and after stress exposure using the methodology described in Lackner et al. :

      • Multiply the percentage of mRNA in each fraction by weights (1-4)

      • Sum the results to obtain translational scores

      • Calculate translational ratios by dividing stress condition scores by control scores

  • Stress Resistance Assays:

    • Expose wild-type and SPAC688.12C-knockout cells to increasing levels of stressors

    • Measure survival rates and growth curves

    • Determine EC50 values for various stressors

  • Protein Expression Analysis:

    • Monitor SPAC688.12C expression levels under different stress conditions

    • Use qPCR and Western blotting to track changes

    • Determine if expression correlates with the core environmental stress response (CESR) genes

  • Protein Modification Analysis:

    • Check for post-translational modifications induced by stress

    • Use phospho-specific antibodies or mass spectrometry

    • Identify potential regulatory sites

How might SPAC688.12C relate to chromatin regulation and gene expression?

Given that other proteins have been found to interact with chromatin modifications such as H3K4 methylation , investigating SPAC688.12C's potential role in chromatin regulation would involve:

  • Chromatin Immunoprecipitation (ChIP):

    • Use tagged SPAC688.12C to perform ChIP-seq

    • Identify genomic binding sites

    • Analyze associated histone modifications at binding sites

  • Domain-Based Analysis:

    • Compare SPAC688.12C sequences with known chromatin readers like BRWD2/PHIP

    • Look for conserved domains that might recognize histone modifications

    • Test binding to modified histone peptides using biochemical assays

  • Genetic Interaction Analysis:

    • Create double mutants with known chromatin regulators

    • Look for synthetic lethal or synthetic rescue phenotypes

    • Focus on COMPASS complex components that regulate H3K4 methylation

  • Transcriptional Impact:

    • Perform RNA-seq on knockout strains

    • Analyze changes in expression patterns

    • Identify if affected genes share common chromatin features

The connection to chromatin regulation should be explored due to potential parallels with BRWD proteins, which bind to H3K4 methylation marks and are implicated in similar human conditions that affect COMPASS complex components .

What experimental approaches can determine if SPAC688.12C is involved in translational regulation?

Based on translational regulation studies in S. pombe , the following methodology would be appropriate:

  • Polysome Profiling:

    • Prepare cellular extracts from wild-type and SPAC688.12C-knockout strains

    • Fractionate polysomes on sucrose gradients (typically 4 fractions)

    • Compare translational profiles between conditions

    • Calculate the sum of total differences between profiles as described by Lackner et al.

  • Ribosome Profiling:

    • Perform Ribo-seq to obtain ribosome-protected fragments

    • Compare with total mRNA levels to calculate translation efficiency

    • Look for specific mRNAs affected by SPAC688.12C deletion

  • mRNA Binding Analysis:

    • Use RNA immunoprecipitation (RIP) with tagged SPAC688.12C

    • Identify bound mRNAs through sequencing

    • Analyze bound transcripts for common features (structure, sequence motifs)

  • In vitro Translation Assays:

    • Develop cell-free translation systems with and without purified SPAC688.12C

    • Measure translation rates of reporter constructs

    • Test effects of various stressors on translation efficiency

The data analysis should focus on distinguishing between general translation effects and transcript-specific regulation, using analytical approaches similar to those used for studying stress-regulated translation in S. pombe .

What controls are essential when studying SPAC688.12C function?

When designing experiments to study SPAC688.12C, researchers should implement the following controls based on sound experimental design principles :

  • Genetic Controls:

    • Wild-type strain (positive control)

    • Knockout strain (negative control)

    • Rescue strain (expressing SPAC688.12C in knockout background)

    • Strains with mutations in key domains/residues

    • Empty vector controls for expression studies

  • Experimental Controls:

    • Technical replicates (minimum 3)

    • Biological replicates (minimum 3)

    • Time-matched controls for time-course experiments

    • Vehicle controls for chemical treatments

    • Isogenic controls differing only in the variable of interest

  • Analysis Controls:

    • Housekeeping genes for normalization in expression studies

    • Loading controls for Western blots

    • Randomization of samples to avoid batch effects

    • Blinding of sample identity during analysis when possible

These controls help minimize several types of research bias, including sampling bias and survivorship bias .

How should experiments be designed to resolve contradictory data about SPAC688.12C?

When faced with contradictory data about SPAC688.12C function, apply these methodological approaches:

  • Systematic Variation of Experimental Conditions:

    • Test multiple growth conditions (media composition, temperature)

    • Vary protein expression levels (low, medium, high)

    • Examine effects at different cell cycle stages

    • Consider strain background effects

  • Multi-method Validation:

    • Confirm key findings using orthogonal techniques

    • For protein interactions: use both in vivo (co-IP) and in vitro (pull-down) methods

    • For localization: combine fluorescence microscopy with biochemical fractionation

    • For functional effects: pair genetic studies with biochemical assays

  • Statistical Approach:

    • Increase sample size to improve statistical power

    • Use appropriate statistical tests based on data distribution

    • Apply multiple testing correction for high-throughput data

    • Consider meta-analysis approaches to integrate contradictory datasets

  • Collaboration and Verification:

    • Engage independent laboratories to verify key findings

    • Share reagents, protocols, and raw data to ensure reproducibility

    • Consider using different model systems to test conservation of function

This approach follows sound experimental design principles while addressing the specific challenges of working with an uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.