Recombinant Schizosaccharomyces pombe Uncharacterized protein C887.16 (SPBC887.16)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Schizosaccharomyces pombe Uncharacterized Protein C(SPBC887.16)

SPBC887.16 is a recombinant protein derived from Schizosaccharomyces pombe (fission yeast), a model organism for studying eukaryotic genetics and cellular processes. The protein is produced via heterologous expression systems and retains its full-length sequence (109 amino acids). Despite its classification as "uncharacterized," genomic and functional studies hint at potential roles in chromatin organization or transcriptional regulation.

Genomic Localization

SPBC887.16 is located on chromosome SPB (S. pombe chromosome) and is transcribed as a single-exon gene. Genomic studies reveal:

  • Promoter Binding: The gene’s promoter region is enriched for Zas1, a transcription factor critical for mitotic chromosome condensation .

  • Protein Interaction Networks: Predicted functional partners include SPAC56F8.13, SPAC56F8.15, and SPBC713.13, suggesting involvement in chromatin dynamics or membrane-associated processes .

Functional Hypotheses

AssociationPotential RoleEvidence
Zas1 BindingRegulation of gene expression during mitosisChIP-seq data showing Zas1 enrichment at SPBC887.16 promoter
Membrane LocalizationInvolvement in transmembrane processes (e.g., transport or signaling)Sequence similarity to transmembrane proteins (e.g., SPBC713.13)

Experimental Tools

SPBC887.16 is commercially available as a recombinant protein for:

  • ELISA Assays: Quantification of protein levels in S. pombe lysates .

  • Functional Studies: Exploration of interactions with Zas1 or other chromatin regulators.

Knowledge Gaps

  • Lack of Functional Data: No direct evidence links SPBC887.16 to specific cellular processes.

  • Limited Orthologs: Absence of homologs in S. cerevisiae or other model organisms limits comparative analysis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize development of the specified tag.
Synonyms
SPBC887.16; Uncharacterized protein C887.16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC887.16
Target Protein Sequence
MARTNLQYPYKVLWCAQVKVVKTGLINFFAPSIQRQRERVCEGYLHETPLLLMQVVEREA ITLAKTEFKNSFSNLHFFFLFWLLNFILFFRIHLYSCNFRMSIICEEYY
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Known About the Structural Characteristics of SPBC887.16?

SPBC887.16 is a short protein with an open reading frame (ORF) of 109 amino acids in length. It belongs to a category of small, dubious peptides that have been questioned regarding their potential involvement in chromosome condensation .

Methodological Approach to Structural Characterization:

For uncharacterized small proteins like SPBC887.16, a multi-faceted approach is recommended:

  • Computational Analysis:

    • Secondary structure prediction using JPred4, PSIPRED

    • Disorder prediction using IUPred, PONDR

    • Domain identification using InterProScan, SMART

  • Experimental Validation:

    • Circular dichroism (CD) spectroscopy

    • Limited proteolysis coupled with mass spectrometry

    • NMR for small, soluble proteins

ApproachAdvantagesLimitationsSuitable for SPBC887.16
Homology ModelingFast, inexpensiveRequires reliable templateLimited due to poor characterization
CD SpectroscopyLow sample requirementLimited resolutionYes, provides secondary structure information
NMR SpectroscopyAtomic resolution for small proteinsRequires soluble proteinPotentially, given its small size (109aa)
X-ray CrystallographyHigh resolutionRequires crystallizationChallenging for small, potentially disordered proteins

How Does SPBC887.16 Expression Change During the Cell Cycle and Meiosis?

Analysis of fission yeast meiosis transcriptome data has revealed complex patterns of gene expression and alternative splicing during reproductive processes. While SPBC887.16-specific expression patterns aren't detailed in current literature, related fission yeast genes show significant regulation during meiosis .

Methodological Approach to Expression Analysis:

  • Synchronization Methods for Cell Cycle Analysis:

    • Temperature-sensitive cdc mutants

    • Nitrogen starvation followed by release

    • Lactose gradient centrifugation

  • Expression Quantification:

    • RT-qPCR targeting SPBC887.16 mRNA

    • Ribosome profiling to assess translation efficiency

    • Western blotting with epitope-tagged SPBC887.16

  • High-throughput Methods:

    • RNA-seq across synchronized timepoints

    • CAGE-seq for transcription start site identification

    • Nascent RNA capture to measure transcription rates

Recommended Expression Systems:

For small proteins like SPBC887.16 (109aa), several expression systems can be considered, each with distinct advantages:

  • E. coli Expression:

    • BL21(DE3) strain with pET vector system

    • Fusion tags: MBP or GST for improved solubility

    • Cold-shock expression to reduce inclusion bodies

  • S. pombe Expression:

    • Homologous expression using pREP vectors

    • nmt1 promoter for controlled induction

    • C-terminal tagging to preserve N-terminal structures

  • Cell-Free Protein Synthesis:

    • Wheat germ extract for difficult-to-express proteins

    • Direct incorporation of modified amino acids

    • Rapid screening of expression conditions

Expression SystemYieldAuthenticityPost-translational ModificationsRecommendation for SPBC887.16
E. coliHighModerateLimitedFirst choice due to simplicity and yield
S. pombeModerateHighNativeSecond choice, especially if PTMs suspected
Cell-freeLow-ModerateVariableDependent on extract sourceFor rapid testing or if other systems fail
MammalianLowVariableExtensiveNot recommended for initial studies

What Approaches Are Recommended for Investigating SPBC887.16 Localization?

Understanding protein localization is critical for functional characterization of uncharacterized proteins like SPBC887.16.

Methodological Approaches:

  • Fluorescent Protein Tagging:

    • C-terminal mNeonGreen or mScarlet tagging

    • Integration at endogenous locus to maintain native expression

    • Live-cell imaging across cell cycle and stress conditions

  • Immunofluorescence:

    • Anti-tag antibodies if direct antibodies unavailable

    • Fixation optimization for small proteins

    • Co-localization with nuclear or chromosomal markers

  • Biochemical Fractionation:

    • Chromatin fractionation to test chromosome association

    • Nucleolar, nuclear, and cytoplasmic separation

    • Western blot analysis of fractions

  • Advanced Microscopy:

    • PALM/STORM super-resolution microscopy

    • FRAP analysis for dynamic behavior

    • Single-molecule tracking for detailed movement patterns

How Can Researchers Determine if SPBC887.16 Is Involved in Chromosome Condensation?

Given the previous suggestion of SPBC887.16's potential involvement in chromosome condensation , rigorous experimental approaches are needed to test this hypothesis.

Methodological Approaches:

  • Genetic Analysis:

    • CRISPR-Cas9 deletion/mutation of SPBC887.16

    • Temperature-sensitive alleles for conditional studies

    • Overexpression phenotype assessment

  • Chromosome Condensation Assays:

    • Microscopy-based condensation measurements using FROS (Fluorescent Repressor Operator System)

    • Live-cell imaging of tagged condensin components

    • FISH analysis of specific chromosomal loci

  • Biochemical Interaction Studies:

    • Co-immunoprecipitation with condensin subunits

    • Proximity labeling (BioID, APEX) near centromeres

    • In vitro interaction studies with purified components

  • Functional Assays:

    • Chromosome segregation error rates in mutants

    • Sensitivity to microtubule inhibitors

    • Synthetic genetic interactions with known condensation factors

Assay TypeInformation GainedTechnical DifficultyRecommendation
FROS-based condensation assayDirect measurement of condensationHighStrong recommendation based on established protocol
Condensin localizationIndirect evidence of functionMediumSecondary approach
Genetic interaction screeningPathway positioningHighComprehensive but resource-intensive
Biochemical interactionsPhysical associationsMediumComplement with in vivo approaches

What Bioinformatic Tools Are Most Appropriate for Analyzing SPBC887.16 Conservation?

For poorly characterized proteins like SPBC887.16, evolutionary analysis can provide important functional clues.

Methodological Approaches:

  • Homology Searches:

    • PSI-BLAST with optimized parameters for short sequences

    • HHpred for remote homology detection

    • Jackhmmer for iterative sequence searches

  • Phylogenetic Analysis:

    • Multiple sequence alignment of homologs

    • Maximum likelihood phylogenetic tree construction

    • Identification of conserved residues/motifs

  • Synteny Analysis:

    • Examination of genomic context across species

    • Identification of conserved gene neighborhoods

    • Detection of operonic arrangements in distant species

  • Advanced Conservation Analysis:

    • Rate4Site for evolutionary rate analysis

    • ConSurf for mapping conservation onto predicted structures

    • Prediction of functional sites based on evolutionary constraints

What High-Throughput Screening Approaches Can Identify SPBC887.16 Interaction Partners?

Identifying protein interaction partners is crucial for understanding the function of uncharacterized proteins like SPBC887.16.

Methodological Approaches:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Tandem affinity purification with stringent controls

    • SILAC labeling for quantitative interaction analysis

    • Crosslinking protocols optimized for transient interactions

  • Proximity-Based Methods:

    • BioID fusion for proximal protein identification

    • APEX2 for temporal proximity mapping

    • Split-TurboID for conditional proximity labeling

  • Genetic Interaction Screens:

    • Synthetic genetic array (SGA) analysis

    • Barcode-fusion genetics for high-throughput screening

    • CRISPR interference screens in combination with SPBC887.16 deletion

  • Yeast Two-Hybrid Variants:

    • Membrane yeast two-hybrid for membrane-proximal proteins

    • Split-ubiquitin yeast two-hybrid

    • Cytosolic yeast two-hybrid screening

How Can Alternative Splicing Analysis Inform SPBC887.16 Function?

Recent studies have identified extensive alternative splicing in S. pombe, particularly during meiosis, which could impact SPBC887.16 expression or function .

Methodological Approaches:

  • Transcriptome Analysis:

    • Iso-Seq long-read sequencing for isoform detection

    • RNA-seq with junction analysis

    • Direct RNA nanopore sequencing

  • Isoform Validation:

    • RT-PCR targeting predicted splice junctions

    • Northern blotting for major isoforms

    • 5' and 3' RACE for terminal identification

  • Functional Analysis of Isoforms:

    • Isoform-specific tagging and localization

    • Isoform-specific complementation tests

    • Translation efficiency analysis by polysome profiling

Based on previous studies of S. pombe, alternative splicing could generate novel protein isoforms with distinct functions, even from genes previously considered simple or monoexonic .

What Are Effective Approaches for Analyzing SPBC887.16 in the Context of Stress Response?

S. pombe spores exhibit stress resistance mechanisms that could involve proteins like SPBC887.16, particularly in response to temperature stress .

Methodological Approaches:

  • Stress Condition Analysis:

    • Thermal stress (heat shock, cold shock)

    • Oxidative stress (H₂O₂, menadione)

    • Nutritional stress (carbon or nitrogen limitation)

  • Expression Analysis Under Stress:

    • RT-qPCR for targeted analysis

    • RNA-seq for genome-wide context

    • Proteomics for post-transcriptional regulation

  • Phenotypic Characterization:

    • Viability assays of deletion mutants under stress

    • Growth rate measurements under varying conditions

    • Competition assays in mixed populations

  • Stress Granule Association:

    • Co-localization with stress granule markers

    • FRAP analysis for dynamic association

    • Immunoprecipitation of stress granule components

How Can CRISPR-Cas9 Be Optimized for SPBC887.16 Functional Studies?

CRISPR-Cas9 technology has been adapted for use in S. pombe and offers powerful approaches for studying uncharacterized genes like SPBC887.16.

Methodological Approaches:

  • Gene Editing Strategies:

    • Complete gene deletion with antibiotic resistance marker

    • Point mutations in conserved residues

    • Epitope tagging at N- or C-terminus

  • Guide RNA Design:

    • Multiple guide RNAs targeting different regions

    • Off-target prediction using CHOPCHOP or CRISPOR

    • Optimization for small genes like SPBC887.16

  • Delivery Methods:

    • Plasmid-based expression

    • Ribonucleoprotein (RNP) complex transformation

    • Conditional Cas9 expression systems

  • Validation Approaches:

    • PCR-based genotyping

    • Sanger sequencing of edited regions

    • Western blotting for tagged versions

Editing StrategyAdvantagesChallenges for SPBC887.16Recommendation
Complete DeletionClear loss-of-functionMay affect neighboring genes if overlap existsUse with careful design to avoid affecting adjacent genes
Point MutationSubtle functional analysisRequires knowledge of key residuesSecond-phase approach after initial characterization
C-terminal TaggingPreserves most of protein functionMay disrupt C-terminal functionsInitial approach for localization studies
N-terminal TaggingLess likely to disrupt function if C-terminus is functionalMay disrupt N-terminal signalsConsider if C-terminal tagging is problematic

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.