Recombinant Schizosaccharomyces pombe Uncharacterized protein C9.08c (SPAC9.08c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
SPAC9.08c; Uncharacterized protein C9.08c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC9.08c
Target Protein Sequence
MFYSDYLKLLKIFVVGVFPCTLFVNAPHGKLAKQSKLFSKGYISGRVGWVLMELVAPLTF LYAIRNNRHFESTLPSLGDGSNRDYLDSCRKVLAGMFLVHYANRALVSPLLMAPQVSPMH WTVFVSAVLFNFLNGMSIGLYLVQASVQHHPVSIIRRYIGMFLWLMGWLGNMYHDNILYD LRRSSNKKKDPDNLDTVQSENSYYRIPYGGLFQYVSCPNYFCEWIEWFGCYLAAGPSAEP FWWFFLSEILLMLPRALKAHQWYCKKFPKYPANRRAIIPFLM
Uniprot No.

Target Background

Database Links
Protein Families
Steroid 5-alpha reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SPAC9.08c and what are its predicted functions in S. pombe?

SPAC9.08c is a protein-coding gene from Schizosaccharomyces pombe (fission yeast) that encodes a putative steroid reductase. It has the Entrez Gene ID 2543655 and is classified as a steroid reductase based on sequence homology . The protein is relatively conserved across species, with homologs found in multiple organisms including humans (SRD5A1), mouse (Srd5a1), and plants like rice (Os11g0184100) .

What is known about the evolutionary conservation of SPAC9.08c across species?

SPAC9.08c shows significant conservation across diverse eukaryotic species, suggesting an ancient and functionally important role. Below is a comparison table of SPAC9.08c homologs across multiple species:

SpeciesGene SymbolProtein Accession
Homo sapiens (human)SRD5A1NP_001038.1
Mus musculus (house mouse)Srd5a1NP_780492.2
Schizosaccharomyces pombe (fission yeast)SPAC9.08cNP_593351.1
Oryza sativa (rice)Os11g0184100NP_001176391.1
Canis lupus familiaris (dog)SRD5A1XP_535799.2
Gallus gallus (chicken)SRD5A1XP_004935188.1
Xenopus tropicalis (tropical clawed frog)srd5a1NP_001006841.1
Pan troglodytes (chimpanzee)SRD5A1XP_001144570.1
Rattus norvegicus (Norway rat)Srd5a1NP_058766.2
Arabidopsis thaliana (thale cress)DET2NP_181340.1
Danio rerio (zebrafish)srd5a1NP_001070121.1

This wide conservation across vertebrates, invertebrates, fungi, and plants indicates that SPAC9.08c homologs likely perform fundamental metabolic functions . The presence of related proteins in both mammals and plants suggests an ancient evolutionary origin predating the divergence of these lineages.

What experimental design approach is recommended for optimizing recombinant SPAC9.08c expression?

A multivariant statistical experimental design methodology is strongly recommended for optimizing SPAC9.08c expression. This approach allows researchers to evaluate multiple variables simultaneously, characterize experimental error, and gather high-quality information with fewer experiments compared to traditional univariant methods .

Recommended approach:

  • Fractional factorial screening design: Use a 2^8-4 design (with two levels for each of 8 variables) with central point replicates to identify significant variables affecting protein expression.

  • Key variables to investigate:

    • Induction absorbance (cell density at induction)

    • IPTG concentration

    • Expression temperature

    • Media components (yeast extract, tryptone, glucose)

    • Induction time

  • Response variables to measure:

    • Cell growth (absorbance)

    • Protein activity (using appropriate assays)

    • Process productivity (protein yield normalized to time)

Based on data from similar recombinant proteins, the following variables typically show significant effects:

VariableEffect on Cell Growthp-valueEffect on Protein Activityp-value
Induction absorbance1.43<0.0001323.50.0016
IPTG-0.420.0387-52.00.5422
Expression temperature1.13<0.0001-340.80.0011
Yeast extract0.860.000477.00.3706
Tryptone0.670.0027268.20.0061
Glucose-0.330.0920164.30.0685

Note that expression temperature often shows a negative effect on protein activity despite enhancing cell growth, suggesting a trade-off between yield and proper folding .

What chromatography methods are most effective for purifying recombinant SPAC9.08c?

A two-step chromatography approach is recommended for purifying recombinant SPAC9.08c to obtain high purity and activity:

Step 1: Immobilized Metal Affinity Chromatography (IMAC)

  • Express SPAC9.08c with a C-terminal hexa-histidine tag (His6-Tag).

  • Use the ÄKTApurifier system with a 1 mL HisTrap FF Crude column.

  • Use 1 mL/min flow rate for all IMAC steps with the following protocol:

    • Wash column with 5 column volumes (CVs) of double-distilled water

    • Equilibrate with 5 CVs of washing buffer containing 25 mM imidazole

    • Load clarified cell lysate

    • Wash with 10 CVs of washing buffer

    • Elute protein using a stepwise imidazole gradient (50 mM, 100 mM, 250 mM, 500 mM)

Step 2: Size Exclusion Chromatography (SEC)

  • Use a HiLoad 16/600 Superdex 200 Prep Grade column.

  • Load pooled IMAC fractions containing the target protein.

  • Use a flow rate of 0.3 mL/min for optimal resolution.

  • Collect 1 mL fractions during elution.

  • Analyze fractions by SDS-PAGE with Coomassie-R250 staining to identify pure fractions .

This protocol typically yields protein with approximately 75% homogeneity and preserved functional activity .

How can researchers assess the quality and activity of purified recombinant SPAC9.08c?

Assessment of purified SPAC9.08c should include multiple quality control methods:

Purity assessment:

  • SDS-PAGE (8% gel) with Coomassie-R250 staining to evaluate protein purity

  • Western blot using anti-His antibodies to confirm identity

  • Size exclusion chromatography profile analysis to detect aggregation or degradation

Structural integrity:

  • Circular dichroism spectroscopy to evaluate secondary structure

  • Thermal shift assays to assess stability

  • Dynamic light scattering to check for proper folding and absence of aggregation

Activity assays:
Since SPAC9.08c is predicted to be a steroid reductase, activity can be measured by:

  • Spectrophotometric assays monitoring NADPH consumption at 340 nm

  • HPLC analysis of substrate-to-product conversion

  • Mass spectrometry to identify and quantify reaction products

When testing enzyme activity, researchers should consider multiple potential steroid substrates given the uncharacterized nature of this protein's specific function .

What methods are most reliable for determining if SPAC9.08c is essential for S. pombe viability?

To determine if SPAC9.08c is essential for S. pombe viability, a systematic approach using gene deletion techniques is recommended:

Method 1: PCR-based deletion in diploid cells (Standard approach)

  • Generate a gene deletion cassette containing a selectable marker (e.g., KanMX6) flanked by sequences homologous to regions upstream and downstream of SPAC9.08c.

  • Transform cassette into diploid S. pombe cells.

  • Select transformants on appropriate medium.

  • Confirm heterozygous deletion by PCR.

  • Induce sporulation of heterozygous diploids.

  • Perform tetrad dissection and analyze viability patterns.

  • If no viable haploid deletants are recovered, the gene is likely essential .

Method 2: Plasmid-based deletion for difficult genes
If the PCR-based method fails (which happens for approximately 8-9 genes within an 18 kb region), use a plasmid-based approach:

  • Create a plasmid containing larger homologous regions (>1 kb) flanking the SPAC9.08c gene.

  • Include a selectable marker between these homologous regions.

  • Linearize the plasmid before transformation to enhance recombination efficiency.

  • This approach has been successful in deleting genes resistant to PCR-based methods .

The essentiality determination should consider that approximately 17.5-20% of S. pombe genes are essential, and genes conserved throughout evolution are more likely to be essential than species-specific genes .

What experimental design approaches are most effective for characterizing SPAC9.08c function?

To characterize SPAC9.08c function, a comprehensive experimental design approach incorporating multiple techniques is necessary:

Basic experimental design principles:

  • Include appropriate controls (positive, negative, and vehicle controls)

  • Perform at least three biological replicates

  • Ensure proper randomization and blinding where applicable

  • Include multiple levels of the independent variable to establish dose-response relationships

  • Carefully document experimental procedures with labeled diagrams

Functional characterization approach:

  • Conditional expression systems:

    • Create strains with SPAC9.08c under control of the nmt1 promoter (thiamine-repressible)

    • Generate temperature-sensitive alleles if SPAC9.08c is essential

    • Use auxin-inducible degron system for rapid protein depletion

  • Phenotypic analysis:

    • Growth assays under various conditions (temperature, pH, osmotic stress)

    • Cell morphology and cell cycle analysis

    • Stress response profiling

    • Metabolic profiling, especially of steroid compounds

  • Localization studies:

    • C-terminal GFP tagging of SPAC9.08c at its genomic locus

    • Colocalization with organelle markers

    • Live-cell imaging to track dynamics

  • Interaction studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation with tagged SPAC9.08c

    • Synthetic genetic array analysis to identify genetic interactions

  • Biochemical analysis:

    • In vitro enzyme assays with purified protein

    • Substrate specificity determination

    • Structure-function relationship studies through mutagenesis

How can researchers distinguish between the direct and indirect effects of SPAC9.08c manipulation?

Distinguishing between direct and indirect effects of SPAC9.08c manipulation requires careful experimental design:

1. Temporal analysis:

  • Use time-course experiments with rapid induction/repression systems

  • Early effects (minutes to hours) are more likely to be direct

  • Later effects (hours to days) may represent secondary consequences

2. Dosage-dependent studies:

  • Create strains with varying levels of SPAC9.08c expression

  • Direct effects typically show stronger dose-dependence

  • Analyze correlation between SPAC9.08c levels and phenotypic outcomes

3. Rescue experiments:

  • Complement deletion with wild-type SPAC9.08c

  • Introduce specific point mutations to identify critical residues

  • Create chimeric proteins with homologs to identify functional domains

4. Biochemical validation:

  • Perform in vitro assays with purified components

  • Reconstitute pathways with defined components

  • Use metabolic labeling to track substrate conversion

5. Control for experimental variables:

  • Include proper internal control (unchanged gene)

  • Use multiple experimental designs to triangulate results

  • Consider interaction between variables using factorial designs

The use of proper experimental controls, as outlined in experimental design principles, is critical for distinguishing direct from indirect effects, particularly when addressing internal validity concerns .

How can comparative genomics inform our understanding of SPAC9.08c function?

Comparative genomics provides valuable insights into SPAC9.08c function through evolutionary analysis:

1. Phylogenetic profiling:

  • Map the presence/absence of SPAC9.08c homologs across species

  • Identify co-evolving genes that may function in related pathways

  • Determine if SPAC9.08c belongs to the category of "ancient genes" conserved throughout evolution

2. Sequence conservation analysis:

  • Identify highly conserved domains and residues likely critical for function

  • Map conservation onto predicted structural models

  • Compare conservation patterns with known steroid reductases

3. Synthetic genetic interactions:

  • Compare genetic interaction networks across species

  • Identify conserved genetic interactions suggesting fundamental pathway relationships

  • Use cross-species complementation to test functional conservation

4. Transcriptional regulation:

  • Compare promoter regions across Schizosaccharomyces species

  • Identify conserved regulatory elements

  • Analyze co-expression patterns with orthologs in other species

Based on studies of other S. pombe genes, the timing of SPAC9.08c's evolutionary appearance and its conservation across different branches of the tree of life can predict whether it is likely to be essential. Genes that appeared early in evolution and are conserved across multiple lineages tend to have higher probabilities of being essential .

What challenges might researchers encounter when working with SPAC9.08c and how can they be addressed?

Researchers working with SPAC9.08c may encounter several challenges:

1. Gene deletion difficulties:

  • Challenge: SPAC9.08c may be located in a chromosomal region resistant to PCR-based deletion methods, like the 18 kb region described where 8 of 9 genes could not be deleted using standard methods .

  • Solution: Use plasmid-based deletion strategies with larger homologous regions (>1 kb) or employ CRISPR-Cas9 genome editing with multiple guide RNAs .

2. Protein expression and solubility:

  • Challenge: Membrane-associated proteins like steroid reductases often have solubility issues.

  • Solution: Optimize expression using DoE approaches, test multiple tags and fusion partners, and use specialized detergents or nanodiscs for purification .

3. Functional redundancy:

  • Challenge: Potential overlap with other reductases may mask phenotypes.

  • Solution: Create multiple gene deletions to eliminate redundant functions, or use sensitized genetic backgrounds.

4. Substrate identification:

  • Challenge: Unknown substrate specificity complicates functional characterization.

  • Solution: Perform untargeted metabolomics comparing wild-type and mutant strains, followed by targeted validation of candidate substrates.

5. Genetic variation in expression:

  • Challenge: Chromatin structure differences may affect gene expression, as suggested by regions showing low efficiency of targeted gene deletion .

  • Solution: Use multiple integration sites or inducible promoters to standardize expression levels.

6. Distinguishing cellular roles from biochemical functions:

  • Challenge: Connecting in vitro enzymatic activity to in vivo phenotypes.

  • Solution: Integrate multi-omics data (transcriptomics, proteomics, metabolomics) with phenotypic analysis under various conditions.

How can Design of Experiments (DoE) methodology improve research on SPAC9.08c beyond expression optimization?

Design of Experiments (DoE) methodology can significantly enhance research on SPAC9.08c across multiple aspects:

1. Protein structure-function studies:

  • Apply fractional factorial designs to systematically investigate how amino acid substitutions affect activity

  • Use response surface methodology to optimize buffer conditions for structural studies

  • Implement definitive screening designs to identify critical residues with minimal experiments

2. Metabolic pathway mapping:

  • Design experiments that vary multiple pathway components simultaneously

  • Use DoE to identify interactions between SPAC9.08c and other enzymes

  • Optimize metabolite extraction and detection methods

3. Genetic interaction analysis:

  • Apply DoE to efficiently map genetic interactions between SPAC9.08c and other genes

  • Design screens that incorporate multiple environmental conditions

  • Identify higher-order genetic interactions that might be missed in traditional approaches

4. In vivo phenotypic characterization:

  • Use DoE to systematically explore phenotypes under varying conditions

  • Identify condition-specific requirements for SPAC9.08c

  • Optimize microscopy conditions for detecting subtle phenotypes

A practical example of DoE application would be a definitive screening design with center points as described in study :

  • Identify 4-6 key factors (e.g., temperature, pH, substrate concentration, cofactor level)

  • Design an experiment with high/low levels for each factor plus center points

  • Analyze the data to generate predictive models of SPAC9.08c function

  • Use model refinement to remove non-significant factors and improve predictive power

How does research on SPAC9.08c contribute to our understanding of essential gene networks in yeast?

Research on SPAC9.08c provides valuable insights into essential gene networks in S. pombe and beyond:

1. Essential gene patterns:

  • Studies indicate that approximately 17.5-20% of S. pombe genes are essential for viability on rich medium, similar to the 17.8% in S. cerevisiae .

  • SPAC9.08c's essentiality status would contribute to our understanding of which types of genes are indispensable for cellular function.

2. Evolutionary conservation and essentiality:

  • Ancient genes appearing early in evolution and conserved across lineages are more likely to be essential.

  • SPAC9.08c shows conservation across diverse species from yeast to humans, suggesting potential evolutionary importance .

3. Chromosomal organization patterns:

  • Some chromosomal regions, such as the 18 kb region identified in chromosome II containing 9 genes (8 of which could not be deleted), may have special properties affecting gene manipulation.

  • These regions are not cold spots for meiotic recombination but may have distinct chromatin structures affecting homologous recombination efficiency .

4. Comparative essentiality:
Analysis of SPAC9.08c essentiality compared to its homologs in other species can reveal:

  • Lineage-specific adaptations in metabolic networks

  • Differences in genetic robustness between species

  • Potential drug targets when essential in pathogens but not humans

5. Functional modules:

  • Through synthetic genetic array analysis, SPAC9.08c can be positioned within the context of functional modules and pathways

  • Understanding how these modules are integrated provides insights into cellular organization

What approaches can be used to resolve contradictory findings about SPAC9.08c function or essentiality?

When faced with contradictory findings regarding SPAC9.08c function or essentiality, researchers should employ a systematic approach to resolution:

1. Methodological differences analysis:

  • Compare gene deletion techniques (PCR-based vs. plasmid-based approaches)

  • Assess strain background differences (auxotrophies, ploidy, genetic markers)

  • Evaluate growth conditions (media composition, temperature, pH)

  • Consider the length of homologous regions used for gene targeting, as this significantly affects deletion efficiency

2. Conditional essentiality investigation:

  • Test essentiality under various growth conditions

  • Create conditional alleles (temperature-sensitive, auxin-inducible)

  • Use partial repression systems to identify threshold requirements

3. Replication with standardized protocols:

  • Establish a standard operating procedure agreed upon by multiple laboratories

  • Perform replicate experiments in different laboratories

  • Use multiple independent techniques to answer the same question

4. Integrative analysis:

  • Combine data from multiple approaches (genetic, biochemical, structural)

  • Develop models that can explain seemingly contradictory results

  • Use Bayesian approaches to weigh evidence from different sources

5. Contextual dependencies:

  • Investigate genetic background effects by creating deletions in multiple strain backgrounds

  • Test for suppressor mutations that might arise to compensate for SPAC9.08c loss

  • Consider epigenetic factors that might influence experimental outcomes

How can systems biology approaches enhance our understanding of SPAC9.08c in cellular metabolism?

Systems biology approaches offer powerful ways to contextualize SPAC9.08c within broader cellular networks:

1. Multi-omics integration:

  • Combine transcriptomics, proteomics, metabolomics, and lipidomics data from wild-type and SPAC9.08c mutant strains

  • Identify altered pathways and metabolites using pathway enrichment analysis

  • Construct regulatory networks to understand downstream effects of SPAC9.08c perturbation

2. Genome-scale metabolic modeling:

  • Incorporate SPAC9.08c and its biochemical reactions into existing S. pombe metabolic models

  • Perform flux balance analysis to predict metabolic consequences of SPAC9.08c manipulation

  • Use metabolic control analysis to determine the control coefficient of SPAC9.08c in relevant pathways

3. Network analysis:

  • Construct protein-protein interaction networks centered on SPAC9.08c

  • Identify hub proteins and network motifs that include SPAC9.08c

  • Compare network perturbations across different conditions

4. Comparative systems biology:

  • Compare SPAC9.08c-centered networks across species

  • Identify conserved and divergent regulatory patterns

  • Leverage knowledge from well-studied homologs like human SRD5A1

5. Mathematical modeling:

  • Develop kinetic models of pathways involving SPAC9.08c

  • Simulate the effects of SPAC9.08c perturbations on metabolic fluxes

  • Test model predictions with targeted experiments

6. High-throughput phenotyping:

  • Perform systematic phenotypic analysis of SPAC9.08c mutants under hundreds of conditions

  • Identify condition-specific requirements and genetic interactions

  • Cluster phenotypic profiles to position SPAC9.08c within functional groups

This systems-level understanding would be particularly valuable for a predicted steroid reductase like SPAC9.08c, as it would connect enzymatic function to broader metabolic and signaling networks in the cell.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.