Recombinant Schizosaccharomyces pombe Uncharacterized protein C947.03c (SPBC947.03c)

Shipped with Ice Packs
In Stock

Description

Functional Insights

While SPBC947.03c remains uncharacterized experimentally, homology-based annotations suggest:

  • NatC auxiliary subunit: Likely supports the NatC complex in acetylating proteins with N-terminal methionine residues, influencing protein stability and localization .

  • Sequence conservation: The N-terminal region shares motifs with acetyltransferase-associated domains, though catalytic residues are unconfirmed .

Research Applications

Recombinant SPBC947.03c is primarily used for:

  • Antigen production: ELISA kits utilize this protein for antibody generation .

  • Structural studies: Its small size (13.3 kDa) and solubility make it amenable to crystallography or NMR .

  • Interaction mapping: Potential use in yeast two-hybrid screens to identify binding partners .

Limitations and Knowledge Gaps

  • Functional validation: No peer-reviewed studies directly investigate SPBC947.03c’s role in S. pombe.

  • Localization: Subcellular distribution remains unknown, though NatC subunits typically localize to the cytosol .

  • Post-translational modifications: Undocumented in current databases .

Future Directions

Proteomic studies in S. pombe (e.g., ) highlight the need to integrate SPBC947.03c into systematic interaction networks. CRISPR-based knockout strains or overexpression assays could clarify its role in NatC-mediated acetylation or stress responses .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development accordingly.
Synonyms
naa38; mak31; SPBC947.03c; N-alpha-acetyltransferase 38, NatC auxiliary subunit; N-terminal acetyltransferase C complex subunit naa38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
naa38
Target Protein Sequence
MALHYFLQYDVQILCIALMFSIFRVCISTAIDFTSPKLDEFSLIMENGEILLTSWLNRSV HIEIFDERKFIGKFLCTDREGAAILSNTTEYNKGFSRALGLVVIPGKHIKSFSVRA
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Recombinant Schizosaccharomyces pombe Uncharacterized protein C947.03c?

Recombinant Schizosaccharomyces pombe Uncharacterized protein C947.03c (SPBC947.03c) is a full-length protein (116 amino acids) that is also known as naa38 or mak31. It functions as an N-alpha-acetyltransferase 38, specifically as a NatC auxiliary subunit involved in the N-terminal acetyltransferase C complex. The protein is typically expressed in E. coli with an N-terminal His tag for research purposes and is available in lyophilized powder form . The complete amino acid sequence is: MALHYFLQYDVQILCIALMFSIFRVCISTAIDFTSPKLDEFSLIMENGEILLTSWLNRSVHIEIFDERKFIGKFLCTDREGAAILSNTTEYNKGFSRALGLVVIPGKHIKSFSVRA .

What are the common storage conditions for this protein?

For optimal preservation of Recombinant S. pombe Uncharacterized protein C947.03c, storage at -20°C/-80°C upon receipt is recommended, with aliquoting being necessary for multiple use scenarios. The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . Repeated freeze-thaw cycles should be avoided, and working aliquots can be maintained at 4°C for up to one week . When reconstituting the protein, it should be done in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, and adding 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C .

How does the SPBC947.03c protein relate to other NAA38 proteins?

The SPBC947.03c protein is part of the NAA38 family of proteins, which function as auxiliary subunits in the N-terminal acetyltransferase C (NatC) complex. While initially classified as an uncharacterized protein, research has established its identity as naa38, also known as mak31 . This protein shares functional similarities with NAA38 proteins found in other species, such as zebrafish, human, and mouse versions, all of which are involved in the N-terminal acetylation process . These relationships provide important comparative contexts for researchers investigating protein evolution and conservation of function across different organisms.

How should I design experiments to characterize the function of SPBC947.03c protein?

When designing experiments to characterize the function of SPBC947.03c protein, you should develop a clear research question that is specific, focused, and based on relevant literature . Begin with exploratory experiments to determine protein-protein interactions using techniques such as co-immunoprecipitation or yeast two-hybrid assays. Following this, design explanatory experiments to investigate the specific role of the protein in N-terminal acetylation processes . Utilize comparative approaches by examining the effects of wild-type versus mutant forms of the protein, ensuring your experimental design includes appropriate positive and negative controls to validate findings .

Experimental ApproachResearch Question TypeExample QuestionMethodology
Protein-protein interactionExploratoryWhat proteins interact with SPBC947.03c in the NatC complex?Co-immunoprecipitation, Yeast two-hybrid
Functional characterizationExplanatoryWhat is the effect of SPBC947.03c deletion on N-terminal acetylation?Gene knockout, Mass spectrometry
Structure-function relationshipDescriptiveHow does the structure of SPBC947.03c relate to its function?X-ray crystallography, NMR spectroscopy
Evolutionary conservationComparativeHow does SPBC947.03c compare to human NAA38?Phylogenetic analysis, Sequence alignment

What are the optimal conditions for expressing and purifying recombinant SPBC947.03c protein?

For optimal expression and purification of recombinant SPBC947.03c protein, researchers should implement a systematic experimental design that accounts for multiple variables. The protein is typically expressed in E. coli with an N-terminal His tag, which facilitates purification through metal affinity chromatography . Expression conditions should be optimized by testing different temperatures (16°C, 25°C, and 37°C), induction times (2-24 hours), and IPTG concentrations (0.1-1.0 mM). Purification should involve a multi-step process including affinity chromatography, followed by size exclusion chromatography to achieve >90% purity as determined by SDS-PAGE . Throughout the purification process, buffer optimization is critical, with the final product being most stable in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How can I design experiments to investigate the role of SPBC947.03c in the NatC complex?

To investigate the role of SPBC947.03c in the NatC complex, design a series of experiments that address both structural and functional aspects of the protein. Begin with correlational research questions to establish relationships between SPBC947.03c expression levels and NatC complex activity . Progress to explanatory experiments using CRISPR-Cas9 gene editing to create knockouts or specific mutations in the SPBC947.03c gene, followed by functional assays to measure N-terminal acetylation activity in these mutants compared to wild-type cells . Complementation studies can be performed by expressing human NAA38 in S. pombe cells lacking SPBC947.03c to determine functional conservation. Additionally, design in vitro reconstitution experiments with purified components to analyze the contribution of SPBC947.03c to complex assembly and catalytic efficiency.

What methodologies are most effective for studying protein-protein interactions involving SPBC947.03c?

For studying protein-protein interactions involving SPBC947.03c, researchers should employ multiple complementary methodologies to ensure robust findings. Proximity-based labeling techniques like BioID or APEX2 can identify transient or weak interactions within the cellular environment. These approaches involve fusing the SPBC947.03c protein to a biotin ligase, allowing biotinylation of proximal proteins that can later be identified through mass spectrometry . For direct physical interactions, Surface Plasmon Resonance (SPR) and Isothermal Titration Calorimetry (ITC) provide quantitative binding parameters such as dissociation constants (Kd), while Fluorescence Resonance Energy Transfer (FRET) can visualize interactions in living cells. Crosslinking Mass Spectrometry (XL-MS) offers insights into the structural arrangement of interacting proteins within complexes.

MethodologyAdvantagesLimitationsData Output
Co-ImmunoprecipitationDetects native complexesMay miss transient interactionsQualitative interaction data
Yeast Two-HybridHigh-throughput screeningHigh false positive rateBinary interaction maps
BioID/APEX2Captures transient interactionsRequires protein fusionProximity interaction network
SPR/ITCQuantitative binding parametersRequires purified proteinsBinding constants (Kd, ka, kd)
XL-MSStructural informationComplex data analysisDistance constraints between interacting residues

How can structural biology approaches contribute to understanding SPBC947.03c function?

Structural biology approaches can significantly enhance our understanding of SPBC947.03c function by revealing the molecular architecture that underlies its biochemical activities. X-ray crystallography remains the gold standard for high-resolution protein structure determination, requiring the production of protein crystals followed by diffraction pattern analysis . For SPBC947.03c, this approach would identify key structural motifs involved in protein-protein interactions and substrate binding within the NatC complex. Cryo-electron microscopy (cryo-EM) offers the advantage of visualizing the entire NatC complex with SPBC947.03c in its native state without crystallization. Nuclear Magnetic Resonance (NMR) spectroscopy can provide insights into the dynamic aspects of the protein, especially important for regions involved in substrate recognition or regulatory interactions.

What are the most rigorous approaches for validating SPBC947.03c interactions with potential binding partners?

Validating protein-protein interactions requires multiple independent methodologies to establish confidence in the findings. For SPBC947.03c, initial screening through high-throughput methods should be followed by targeted validation experiments . After identifying potential binding partners through methods like affinity purification-mass spectrometry or yeast two-hybrid screening, researchers should confirm these interactions using orthogonal techniques such as bimolecular fluorescence complementation (BiFC) or FRET/BRET analysis in cells . In vitro validation using purified components should include surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to determine binding kinetics and thermodynamics. Ultimately, functional validation is critical—determining whether disrupting the interaction affects known biological processes associated with SPBC947.03c, such as N-terminal acetylation of specific substrates.

How should I approach conflicting results when studying SPBC947.03c protein interactions?

When facing conflicting results in SPBC947.03c protein interaction studies, a systematic analytical approach is essential. First, conduct a comprehensive evaluation of the experimental methodologies used, as different techniques have varying sensitivities and limitations that may explain discrepancies . Create a comparative analysis table of all findings, noting the experimental conditions, detection methods, and statistical significance of each result . Perform targeted validation experiments using orthogonal techniques to specifically address the conflicting data points. Consider whether the conflicts might reflect biological reality—such as condition-dependent interactions or competitive binding scenarios. Statistical meta-analysis combining data from multiple experiments can help identify consistent trends amid variable results.

Analysis ApproachApplication to Conflicting DataExpected Outcome
Methodological ComparisonEvaluate differences in experimental approachesIdentification of method-dependent biases
Condition MappingTest interactions under varying conditions (pH, salt, temperature)Define parameters that influence interaction stability
Structural AnalysisModel interaction interfaces to predict steric constraintsRationalization of mutually exclusive binding partners
Domain MappingTest interactions with isolated protein domainsIdentification of specific binding regions
Kinetic AnalysisMeasure on/off rates of competing interactionsDetermination of preferential binding hierarchies

What statistical approaches are most appropriate for analyzing SPBC947.03c expression data?

When analyzing SPBC947.03c expression data, the statistical approach should be tailored to the experimental design and data characteristics. For comparing expression levels across different conditions or genotypes, parametric tests like Student's t-test (for two groups) or ANOVA (for multiple groups) are appropriate if the data meet normality assumptions . If normality cannot be established, non-parametric alternatives such as Mann-Whitney U or Kruskal-Wallis tests should be employed. For time-course experiments tracking expression changes, repeated measures ANOVA or mixed-effects models are more suitable. When exploring relationships between SPBC947.03c expression and other variables, correlation analyses (Pearson's or Spearman's) or regression models should be used depending on whether linear relationships are expected .

How can I integrate multi-omics data to better understand SPBC947.03c function?

Integrating multi-omics data provides a comprehensive understanding of SPBC947.03c function within the broader cellular context. Begin by collecting datasets from transcriptomics (RNA-seq), proteomics, interactomics, and possibly metabolomics experiments comparing wild-type and SPBC947.03c mutant cells . Implement computational pipelines that normalize and process each data type appropriately before integration. Network analysis approaches, such as weighted gene co-expression network analysis (WGCNA) or protein-protein interaction networks, can identify functional modules associated with SPBC947.03c . Machine learning algorithms, particularly supervised methods like random forest or support vector machines, can help prioritize genes or proteins most affected by SPBC947.03c perturbation. Finally, pathway enrichment analysis across multiple omics layers can reveal consistent biological processes impacted by SPBC947.03c function.

What are the critical quality control steps when working with recombinant SPBC947.03c?

Quality control of recombinant SPBC947.03c is essential for ensuring experimental reliability and reproducibility. Initially, verify protein identity through mass spectrometry peptide mapping to confirm the amino acid sequence matches the expected SPBC947.03c sequence . Assess purity using SDS-PAGE with both Coomassie staining and silver staining, aiming for >90% purity as specified in the product data . Verify protein folding using circular dichroism spectroscopy to ensure proper secondary structure formation. Test functionality through specific activity assays relevant to NAA38 function, such as in vitro N-terminal acetylation assays with reconstituted NatC complex. Additionally, perform endotoxin testing if the protein will be used in cell-based assays, as contamination can confound results through non-specific cellular responses.

What are the best practices for monitoring post-translational modifications of SPBC947.03c?

Monitoring post-translational modifications (PTMs) of SPBC947.03c requires sophisticated analytical approaches. Mass spectrometry-based proteomics represents the gold standard, specifically employing techniques such as liquid chromatography-tandem mass spectrometry (LC-MS/MS) with electron transfer dissociation (ETD) or higher-energy collisional dissociation (HCD) fragmentation methods . Sample preparation is critical—researchers should implement phosphopeptide enrichment strategies using titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC) for phosphorylation studies, while acetylation analysis benefits from antibody-based enrichment. Western blotting with modification-specific antibodies provides a complementary approach for targeted PTM detection, although this is limited by antibody availability and specificity. For dynamic studies, pulse-chase experiments using stable isotope labeling by amino acids in cell culture (SILAC) can track modification turnover rates.

How can CRISPR-Cas9 technology be applied to study SPBC947.03c function in S. pombe?

CRISPR-Cas9 technology offers powerful approaches for investigating SPBC947.03c function in S. pombe through precise genetic manipulation. When designing CRISPR experiments, researchers should first conduct thorough guide RNA (gRNA) design using tools optimized for S. pombe, selecting targets with minimal off-target effects and maximum on-target efficiency . For complete gene knockout studies, design gRNAs targeting early exons of the SPBC947.03c gene to ensure functional disruption. For more nuanced studies, implement precise edits using homology-directed repair (HDR) with repair templates containing specific mutations or epitope tags. Conditional systems such as auxin-inducible degrons can be integrated to achieve temporal control over protein depletion, allowing for the study of acute loss of function.

CRISPR ApplicationMethodologyResearch Question TypeExample Outcome Measurement
Gene KnockoutComplete deletion of SPBC947.03cExplanatoryPhenotypic analysis, proteome-wide N-terminal acetylation profiling
Point MutationsHDR-mediated introduction of specific mutationsMechanisticStructure-function relationships, substrate specificity changes
TaggingEndogenous tagging with fluorescent proteins or epitopesDescriptiveLocalization studies, protein complex composition
CRISPRi/CRISPRaModulation of gene expression levelsCorrelationalDose-dependent effects on cellular processes
Base EditingPrecise nucleotide substitutions without DSBFunctionalEvaluation of evolutionary conservation of specific residues

What comparative genomics approaches might reveal about SPBC947.03c evolution and function?

Comparative genomics approaches can provide valuable insights into the evolutionary history and functional conservation of SPBC947.03c across species. Researchers should begin with comprehensive phylogenetic analysis of NAA38 homologs across diverse eukaryotic lineages, constructing maximum likelihood or Bayesian trees to establish evolutionary relationships . Sequence conservation analysis using multiple sequence alignment tools can identify functionally critical residues that remain invariant across species, suggesting selective pressure to maintain specific activities. Synteny analysis examining gene neighborhood conservation can reveal evolutionary constraints on genome organization around SPBC947.03c. Positive selection analysis using methods like dN/dS ratio calculation can identify regions under adaptive evolution, potentially highlighting protein-protein interaction interfaces that co-evolve with binding partners.

How might structural prediction tools enhance our understanding of SPBC947.03c function?

Structural prediction tools offer valuable insights into SPBC947.03c function, particularly given the challenges of experimental structure determination. Contemporary approaches employ deep learning methods such as AlphaFold2 and RoseTTAFold, which have revolutionized protein structure prediction by achieving near-experimental accuracy . For SPBC947.03c, these tools can generate high-confidence structural models revealing potential functional domains, binding interfaces, and mechanistic details. Molecular dynamics simulations can further enhance these static models by exploring conformational flexibility and response to binding partners or post-translational modifications . Integrative modeling approaches combining predicted structures with experimental data from cross-linking mass spectrometry or small-angle X-ray scattering can produce refined structural models of SPBC947.03c within the larger NatC complex, elucidating its architectural role and functional contributions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.