Recombinant Schizosaccharomyces pombe Uncharacterized protein C9E9.04 (SPAC9E9.04)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Uncharacterized protein C9E9.04, also known as SPAC9E9.04, is a protein derived from the fission yeast Schizosaccharomyces pombe . S. pombe is a species of yeast that is often used as a model organism to study fundamental biological processes such as cell division, DNA damage response, and heterochromatin formation because of its conserved genomic regions with humans .

PropertyDescription
Product CodeCSB-CF515667SXV
Uniprot No.O14290
Protein NameUncharacterized protein C9E9.04
SourceIn vitro E. coli expression system
Immunogen SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Protein TypeTransmembrane Protein
Expression Region1-188
Tag InfoN-terminal 10xHis-tagged
SequenceMTIYYMIVFMLLMVEIVSFVILSLPLPLKVRRAILNAISNSPFAGRVKHVLKITIICILILFADSVRRVVRVTKEYDLAIAAPSTTESARSGYKASQFYAQRNLYLCGSALFLSLVVNRYYLALEAMIAAQDKMQALQTQVEASTNNAKAVEELETLRTKLETRDKEYETLAEKYAAVTKTVEKKKDI

Structure

Proteins are composed of amino acids arranged in a linear sequence, which determines their structure and function . The primary structure refers to this linear sequence of amino acids . The polypeptide chain folds into secondary structures such as α-helices and β-sheets through local interactions . These secondary structures further fold into a three-dimensional tertiary structure, which is stabilized by various forces including hydrogen bonds, ionic bonds, disulfide bonds, and Van der Waals forces .

SPAC9E9.04 is a transmembrane protein, which means it contains hydrophobic regions that allow it to be embedded within cell membranes .

Function and Research Applications

As an uncharacterized protein, the precise function of SPAC9E9.04 is not yet known . S. pombe is used in genetic and chemical screening for drug target identification, gene expression profiling, and synthetic lethal profiling . The S. pombe Genome-wide Deletion Mutant Library is a tool for large-scale genetic functional analysis, identification and verification research of drug targets, and integrated systems research of cell function .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
SPAC9E9.04; Uncharacterized protein C9E9.04
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC9E9.04
Target Protein Sequence
MTIYYMIVFMLLMVEIVSFVILSLPLPLKVRRAILNAISNSPFAGRVKHVLKITIICILI LFADSVRRVVRVTKEYDLAIAAPSTTESARSGYKASQFYAQRNLYLCGSALFLSLVVNRY YLALEAMIAAQDKMQALQTQVEASTNNAKAVEELETLRTKLETRDKEYETLAEKYAAVTK TVEKKKDI
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What bioinformatic approaches should I use to predict potential functions of SPAC9E9.04?

Begin with comparative genomics to identify sequence homologs across phylogenetic lineages. Uncharacterized proteins conserved across multiple organisms (conserved hypothetical proteins or CHPs) often serve critical cellular functions despite lacking functional validation. Multiple sequence alignment analysis should be employed to identify conserved domains and motifs that may indicate function. For domain identification, use protein family databases like Pfam to search for conserved structural elements .

For a comprehensive bioinformatic workflow, implement the following sequential analysis:

  • Primary sequence analysis: BLAST searches against multiple databases to identify homologs

  • Domain prediction: Search for conserved domains using Pfam, SMART, and CDD

  • Structural prediction: Use tools like I-TASSER or AlphaFold2 to generate tertiary structure models

  • Localization prediction: Employ tools like PSORT to predict subcellular localization

  • Post-translational modification sites: Use NetPhos, NetOGlyc, NetNGlyc for PTM prediction

As demonstrated in studies of other S. pombe proteins, identifying conserved motifs and cysteine residues can provide critical insights into protein function, as seen with spGrx4 which contains conserved cysteine residues in each PF00085 domain .

How can I determine if SPAC9E9.04 participates in protein-protein interactions that might indicate its function?

Protein-protein interaction analysis should be conducted using both computational and experimental approaches. Begin with computational predictions using STRING database, which can identify potential interaction partners based on various evidence types. For experimental validation, consider implementing the following methods:

MethodApplicationAdvantagesLimitations
Yeast Two-Hybrid (Y2H)Binary interaction detectionHigh-throughput capabilityHigh false positive rate
Co-immunoprecipitation (Co-IP)Endogenous complex isolationDetects physiological interactionsRequires specific antibodies
Proximity-based labeling (BioID)Identification of proximal proteinsDetects transient interactionsPotential background labeling
Protein microarraysSystematic interaction screeningHigh-throughputCost-intensive

When analyzing interaction networks, focus particularly on connections to proteins of known function, as these may suggest functional pathways. Similar approaches revealed that S. pombe Grx4 interacts strongly with Php4 and Fep1, providing insights into iron homeostasis mechanisms .

What experimental approaches are most effective for determining the cellular function of SPAC9E9.04?

For functional characterization, implement complementary genetic and biochemical approaches:

Genetic approaches:

  • Gene deletion: Create SPAC9E9.04 knockout strains using homologous recombination or CRISPR-Cas9 systems to observe phenotypic changes

  • Conditional expression systems: Employ regulatable promoters (nmt1, urg1) to control expression levels

  • Fluorescent tagging: Create C- or N-terminal GFP fusions to monitor localization patterns under different conditions

Biochemical approaches:

  • Protein purification and in vitro assays to test predicted biochemical activities

  • Chromatin immunoprecipitation (ChIP) if predicted to interact with chromatin, similar to methods used in epigenetic studies in S. pombe

  • Pull-down assays followed by mass spectrometry to identify interaction partners

Expression analysis under various stress conditions can provide functional clues. For example, differential expression analysis of SPAC9E9.04 under conditions like nutritional stress, temperature changes, and cell cycle arrest might reveal condition-specific regulation patterns, similar to how spgrx4, spfep1, and spphp4 expression varies with iron concentrations .

How should I design experiments to determine if SPAC9E9.04 participates in epigenetic regulation?

If bioinformatic analysis suggests potential involvement in chromatin processes, design experiments focusing on:

  • Chromatin association analysis: Perform ChIP-seq to identify potential genomic binding sites of SPAC9E9.04, particularly examining heterochromatic regions like centromeres, telomeres, and mating-type loci.

  • Genetic interaction studies: Create double mutants with known epigenetic regulators (e.g., clr4Δ, swi6Δ, dcr1Δ) to assess genetic interactions.

  • Transcriptome analysis: Conduct RNA-seq comparing wild-type and SPAC9E9.04Δ strains to identify differentially expressed genes, particularly those in heterochromatic regions.

  • Histone modification analysis: Examine if loss of SPAC9E9.04 affects histone modifications like H3K9 methylation, which is a hallmark of heterochromatin in S. pombe .

  • Position effect variegation assays: Test if deletion affects silencing of reporter genes inserted in heterochromatic regions, similar to PEV studies in S. pombe .

When analyzing results, focus on changes in transcript levels from regions normally silenced by heterochromatin, such as centromeric repeats, as these can indicate disruption of transcriptional gene silencing mechanisms .

What techniques should I use to determine the structural features of recombinant SPAC9E9.04?

For comprehensive structural characterization, implement a multi-tiered approach:

Expression and purification optimization:

  • Test multiple expression systems (E. coli, insect cells, yeast)

  • Optimize buffer conditions using thermal shift assays

  • Apply multiple chromatography steps for highest purity:

    • Affinity chromatography (His-tag, GST-tag)

    • Ion-exchange chromatography

    • Size exclusion chromatography

Structural analysis techniques:

  • Circular dichroism (CD): For secondary structure composition determination

  • Small-angle X-ray scattering (SAXS): For low-resolution shape information in solution

  • X-ray crystallography: For high-resolution structural determination

  • NMR spectroscopy: For structure and dynamics in solution, especially beneficial for flexible regions

  • Cryo-electron microscopy: Particularly useful if part of larger complexes

For validation of structural predictions, compare computational models with experimental structural data, focusing on conserved domains identified through multiple sequence alignment analysis. Just as studies on spGrx4 revealed conserved cysteine residues critical for function, similar conserved features might exist in SPAC9E9.04 .

How can I reliably validate post-translational modifications (PTMs) in SPAC9E9.04?

Mass spectrometry remains the gold standard for PTM identification and validation. Implement the following workflow:

  • Sample preparation:

    • Express recombinant protein in S. pombe to maintain native modification patterns

    • Purify under conditions that preserve PTMs (phosphatase inhibitors, deacetylase inhibitors)

    • Perform both bottom-up (digested peptides) and top-down (intact protein) analyses

  • Mass spectrometry analysis:

    • Use high-resolution instruments (Orbitrap, Q-TOF)

    • Implement fragmentation methods specific to PTM type (ETD for phosphorylation, CID for glycosylation)

    • Perform targeted analyses for predicted modification sites

  • Data analysis:

    • Apply peptide mass fingerprinting techniques to identify modified peptides

    • Validate with manual spectrum interpretation

    • Use multiple search algorithms to increase confidence

  • Site-directed mutagenesis:

    • Create mutants at identified modification sites

    • Assess functional consequences through activity assays and localization studies

For phosphorylation analysis specifically, implement IMAC (Immobilized Metal Affinity Chromatography) enrichment prior to MS analysis to enhance detection sensitivity of low-abundance phosphopeptides .

What approaches should I use to characterize the expression profile of SPAC9E9.04 under different experimental conditions?

A comprehensive expression analysis should include both transcriptional and translational level assessments:

Transcriptional analysis:

  • RT-qPCR: Using gene-specific primers similar to the approach for spgrx4, spfep1, and spphp4 genes, which employed the following primer design strategy:

    • Forward and reverse primers spanning exon junctions

    • Amplicon size between 80-150 bp

    • Reference gene (act1) for normalization

  • RNA-seq: For genome-wide context of expression changes

    • Compare multiple conditions relevant to predicted function

    • Include time-course analyses to capture temporal dynamics

Translational analysis:

  • Western blotting: Using epitope-tagged constructs or specific antibodies

  • Ribosome profiling: To assess translational efficiency

  • Proteomics: Using either label-free or isotope labeling approaches

For expression analysis under stress conditions, consider the following experimental matrix:

ConditionVariablesTime pointsControls
Temperature stress20°C, 30°C, 37°C15, 30, 60 minWild-type strain
Nutrient limitationGlucose, nitrogen1, 3, 6 hoursRich media
Oxidative stressH₂O₂ (0.5mM, 1mM)30, 60, 120 minUntreated cells
Cell cycleG1, S, G2, MN/AAsynchronous culture

When analyzing data, look for condition-specific expression patterns that might correlate with known cellular processes. As demonstrated with iron-responsive genes in S. pombe, expression patterns can vary significantly under different environmental conditions .

How can I design CRISPR-based approaches to study SPAC9E9.04 function in S. pombe?

CRISPR-Cas9 systems have been adapted for S. pombe and offer powerful tools for studying uncharacterized proteins:

  • Gene knockout strategies:

    • Design at least 3 sgRNAs targeting different regions of the SPAC9E9.04 gene

    • Incorporate homology-directed repair templates with selectable markers

    • Verify deletions by PCR and sequencing

  • CRISPRi for conditional repression:

    • Use catalytically dead Cas9 (dCas9) fused to repressive domains

    • Design sgRNAs targeting the promoter region

    • Establish dose-dependent control of expression level

  • CRISPRa for overexpression studies:

    • Employ dCas9 fused to activation domains

    • Target the promoter region to enhance expression

    • Validate overexpression by RT-qPCR and Western blotting

  • Base editing for point mutations:

    • Use Cas9-cytidine or adenine deaminase fusions

    • Target conserved residues identified through sequence analysis

    • Create specific amino acid substitutions without double-strand breaks

  • CRISPR screens:

    • Deploy sgRNA libraries targeting multiple genes

    • Screen for genetic interactions with SPAC9E9.04

    • Identify synthetic lethal or suppressor relationships

When implementing these approaches, include appropriate controls and validate editing efficiency through sequencing before proceeding to phenotypic analyses.

How should I approach data interpretation when results from different methods yield conflicting information about SPAC9E9.04 function?

Conflicting data is common when characterizing uncharacterized proteins and requires systematic resolution:

  • Methodological validation:

    • Verify all experimental methods with positive and negative controls

    • Assess technical reproducibility through replicates

    • Consider method-specific limitations (e.g., tag interference, overexpression artifacts)

  • Hierarchical evidence evaluation:

    • Assign confidence levels to different data types (direct biochemical evidence > genetic interactions > computational predictions)

    • Prioritize in vivo results over in vitro observations

    • Consider evolutionary conservation as a metric for functional significance

  • Integration of multiple data types:

    • Implement Bayesian approaches to weight evidence from different sources

    • Use network analysis to contextualize seemingly disparate results

    • Consider condition-dependence of observations

  • Resolution strategies for specific conflicts:

    • For localization conflicts: Use multiple tagging strategies and fixation methods

    • For phenotypic discrepancies: Test additional strain backgrounds and conditions

    • For biochemical function conflicts: Assess substrate specificity and reaction conditions

  • Community resources:

    • Compare with phenotypes in systematic deletion collections

    • Consult S. pombe-specific databases like PomBase

    • Consider unpublished observations through research community networks

Remember that seemingly conflicting data might reveal condition-specific functions or multiple cellular roles, as seen with proteins like spGrx4 which participates in both iron homeostasis and other cellular processes .

How can I integrate data about SPAC9E9.04 into broader cellular networks to understand its functional context?

Systems biology approaches provide crucial context for understanding uncharacterized proteins:

  • Network analysis:

    • Construct protein-protein interaction networks based on experimental data

    • Identify modules or communities within networks that include SPAC9E9.04

    • Apply graph theory metrics to assess centrality and importance

  • Pathway enrichment:

    • Analyze interaction partners for enrichment in specific biological pathways

    • Use tools like STRING and KEGG to identify potential pathway involvement

    • Assess genetic interaction profiles for pathway insights

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Employ computational methods like WGCNA (Weighted Gene Co-expression Network Analysis)

    • Look for correlation patterns across different data types

  • Evolutionary analysis:

    • Compare with homologs in related species

    • Assess selective pressure through Ka/Ks ratios

    • Identify co-evolving proteins that might function together

  • Temporal dynamics:

    • Analyze expression changes across cell cycle phases

    • Assess response dynamics to environmental perturbations

    • Consider protein degradation rates and stability

When integrating these approaches, focus particularly on connecting SPAC9E9.04 to well-characterized cellular processes, similar to how spGrx4, spFep1, and spPhp4 were integrated into iron homeostasis networks through protein-protein interaction analysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.