Recombinant Schizosaccharomyces pombe Uncharacterized protein P19A11.02c (SPBP19A11.02c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPBP19A11.02c; Uncharacterized protein P19A11.02c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-244
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBP19A11.02c
Target Protein Sequence
QTEYTPGFTTDVATTVTPTPLPSANVTTTSFSSASTETSTHSVTSTNITSIVPPPSTSHN STTTTVPPTTSMNTTTTVPPTTSLNTTTTTAPPTTHVNSTTTVVPPTTHVNTTTVVPPTT HVNTTTVVPPTTHANTTSFVPTTTESSIHPITTGFYNTTFTTGYFNTSVTSVAVHNSTTV FPTSVPIVNTTSFNVTTIPSSAVHYASPSGLLALVVMLISAFAFLA
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is the temporal expression pattern of SPBP19A11.02c during meiosis?

SPBP19A11.02c exhibits a unique temporal pattern of expression during meiosis. While the gene is transcribed in proliferating, early, and late meiotic cells with a notable decrease in mid-meiosis, RNA accumulation is observed primarily at late time points in the meiotic process. This distinctive expression profile differentiates it from most meiotic genes, suggesting specialized regulatory mechanisms controlling its expression .

How does the transcription and RNA accumulation of SPBP19A11.02c compare with other meiotic genes?

According to quantitative analyses, SPBP19A11.02c demonstrates high mRNA levels (1480.10) with relatively high RNA polymerase II occupancy (1.89), resulting in an mRNA/Pol II ratio of 782.50. This ratio ranks it at position 847 among analyzed genes. Unlike many early meiotic genes, SPBP19A11.02c shows detectable RNA accumulation at the 0-hour timepoint (indicated as "Y" in expression analyses), but lacks a Determinant of Selective Removal (DSR) element that is present in some meiotic genes .

What methodologies are commonly used to quantify SPBP19A11.02c expression?

Expression analysis of SPBP19A11.02c typically employs multiple complementary approaches:

  • Semi-quantitative RT-PCR for temporal expression patterns

  • Real-time RT-PCR (qRT-PCR) for precise quantification

  • Microarray analysis for genome-wide expression comparisons

  • RNA polymerase II occupancy assays to measure transcriptional activity

  • Northern blot analysis for validation of RNA size and abundance

For comprehensive characterization, these methods should be combined to distinguish between transcriptional and post-transcriptional regulatory mechanisms affecting SPBP19A11.02c expression .

What are the predicted functional domains of SPBP19A11.02c protein?

While SPBP19A11.02c remains classified as an uncharacterized protein, computational analyses based on sequence homology and structural predictions suggest potential functional domains. Researchers investigating this protein should perform detailed bioinformatic analyses including:

  • Protein sequence alignment with characterized proteins from related species

  • Secondary structure prediction using algorithms such as PSIPRED

  • Identification of conserved motifs using MEME Suite or similar tools

  • Domain prediction using InterProScan, Pfam, and SMART databases

  • Subcellular localization prediction using tools like WoLF PSORT

These analyses can provide initial insights into functional characteristics while experimental validation is pending.

How can researchers express and purify recombinant SPBP19A11.02c for functional studies?

Recombinant expression of SPBP19A11.02c can be accomplished through protocols similar to those used for other S. pombe proteins. A recommended approach includes:

  • Gene synthesis or PCR amplification from S. pombe genomic DNA

  • Cloning into an appropriate expression vector (pET, pGEX, or similar) with His or other affinity tags

  • Expression in E. coli BL21(DE3) or similar strains

  • Optimization of expression conditions (temperature, IPTG concentration, time)

  • Purification using affinity chromatography followed by size exclusion

For challenging expression, alternative systems including S. pombe expression systems may be considered to ensure proper post-translational modifications. Protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, with aliquoting and addition of 30-50% glycerol for long-term storage at -80°C .

What is known about the transcriptional regulation of SPBP19A11.02c during meiosis?

The transcriptional regulation of SPBP19A11.02c during meiosis appears to involve multiple regulatory mechanisms. Based on related meiotic gene studies, several factors likely contribute:

  • Temporal control via meiosis-specific transcription factors

  • Chromatin remodeling events specific to the meiotic program

  • Absence of the DSR element, distinguishing it from many early meiotic genes

  • Potential regulation by the Mmi1 pathway, which controls numerous meiotic transcripts

  • Possible involvement of RNA polymerase II occupancy dynamics

The unique expression pattern of transcription throughout the meiotic process but accumulation only during late meiosis suggests post-transcriptional regulation plays a crucial role in controlling SPBP19A11.02c expression .

How does the absence of a DSR element impact SPBP19A11.02c expression and function?

The absence of a Determinant of Selective Removal (DSR) element in SPBP19A11.02c differentiates it from many other meiotic genes that contain this regulatory element. This has significant implications:

  • DSR-containing transcripts are typically targeted by the Mmi1 protein for degradation during vegetative growth

  • The absence of a DSR suggests SPBP19A11.02c may employ alternative mechanisms to regulate its expression

  • This may explain why SPBP19A11.02c shows RNA accumulation at 0-hour timepoints, unlike DSR-containing genes

  • The absence of DSR-mediated regulation may contribute to its unique temporal expression pattern

  • Research methodologies for studying DSR-independent regulation should include RNA stability assays and identification of alternative regulatory elements

What is known about polyadenylation patterns of SPBP19A11.02c?

While specific data on SPBP19A11.02c polyadenylation is not directly provided in the available research, studies on related meiotic genes in S. pombe have revealed that multiple polyadenylation sites are common features. Research approaches to characterize SPBP19A11.02c polyadenylation should include:

  • RT-PCR with oligo(dT) as the 3′ primer and gene-specific 5′ primers

  • Sequencing of cDNAs to map the precise sites of poly(A) addition

  • Analysis of 3′ UTR lengths in different meiotic stages

  • Comparison with average S. pombe 3′ UTR length (approximately 169 nucleotides)

  • Assessment of differential polyadenylation site usage during meiotic progression

Based on related meiotic genes, SPBP19A11.02c may exhibit stage-specific polyadenylation patterns that contribute to its unique expression profile .

How does the exosome complex impact SPBP19A11.02c RNA stability and accumulation?

The nuclear exosome, particularly the Rrp6 component, plays a crucial role in regulating meiotic gene expression in S. pombe. For SPBP19A11.02c research, the following methodological approaches are recommended:

  • Analysis of SPBP19A11.02c RNA levels in rrp6Δ mutant strains

  • Comparison of polyadenylation patterns between wild-type and exosome-deficient cells

  • Assessment of sensitivity to Mmi1 pathway perturbation

  • Investigation of potential correlation between exosome sensitivity and temporal expression

  • Analysis of nuclear versus cytoplasmic RNA distribution to determine compartment-specific degradation

These experiments would help determine whether SPBP19A11.02c is subject to exosome-mediated RNA degradation despite lacking a conventional DSR element .

What are the optimal methods for detecting SPBP19A11.02c protein in cellular contexts?

For effective detection of endogenous or recombinant SPBP19A11.02c protein in research settings, consider these methodological approaches:

  • Generation of specific antibodies against SPBP19A11.02c by:

    • Expressing recombinant fragments as antigens

    • Peptide synthesis based on predicted antigenic regions

    • Validation using knockout/knockdown controls

  • Epitope tagging strategies:

    • C-terminal or N-terminal tagging with HA, Myc, or FLAG

    • CRISPR-Cas9 genome editing for endogenous tagging

    • Verification that tags do not disrupt protein function

  • Detection methods:

    • Western blotting with optimized extraction buffers for S. pombe

    • Immunofluorescence microscopy for localization studies

    • Chromatin immunoprecipitation (ChIP) if nuclear functions are suspected

    • Mass spectrometry for identification of interaction partners

  • Controls and validation:

    • Use of knockout strains as negative controls

    • Recombinant protein as positive control

    • Synchronization of meiotic cultures for temporal studies

What are the recommended approaches for functional characterization of SPBP19A11.02c?

A comprehensive functional characterization strategy for SPBP19A11.02c should include:

  • Gene deletion/disruption:

    • Construction of knockout strains using homologous recombination

    • Phenotypic analysis focusing on meiotic progression and sporulation

    • Complementation assays to confirm phenotype specificity

  • Temporal expression manipulation:

    • Implementation of controllable promoters (nmt1, urg1)

    • Analyses of effects of premature expression or repression

    • Assessment of dose-dependent phenotypes

  • Protein interaction studies:

    • Yeast two-hybrid screening

    • Affinity purification coupled with mass spectrometry

    • Co-immunoprecipitation assays during different meiotic stages

    • Proximity labeling approaches (BioID, APEX)

  • Localization studies:

    • Live-cell imaging with fluorescent protein fusions

    • Cell fractionation followed by Western blotting

    • Colocalization with known meiotic markers

  • RNA-protein interaction analysis if RNA-binding properties are suspected:

    • RNA immunoprecipitation (RIP)

    • Crosslinking and immunoprecipitation (CLIP) methods

How does SPBP19A11.02c compare to other late meiotic genes in S. pombe?

A comparative analysis between SPBP19A11.02c and other late meiotic genes reveals distinctive characteristics:

Gene nameSystematic name0 h accumulationmRNA levelPol II occupancymRNA/Pol IIRankDSR?
SPBP19A11.02cSPBP19A11.02cY1480.101.89782.50847N
act1SPBC32H8.12cY12,327.216.901786.942452N
atg8SPBP8B7.24cY909.201.32688.53718N
mug142SPBC3H7.09Y963.250.97998.191220N
SPAC1039.11cSPAC1039.11cY1299.550.572285.933059N
SPAC1610.02cSPAC1610.02cY2541.950.982599.133377N

This comparison highlights that SPBP19A11.02c has:

  • High mRNA levels comparable to other late meiotic genes

  • Higher Pol II occupancy than most late genes

  • A mRNA/Pol II ratio that suggests moderate post-transcriptional regulation

  • Absence of a DSR element, consistent with most late meiotic genes

What experimental strategies can differentiate SPBP19A11.02c function from other uncharacterized S. pombe proteins?

To specifically determine the function of SPBP19A11.02c among other uncharacterized S. pombe proteins, researchers should employ:

  • Comparative phenotypic analysis:

    • Creation of a deletion strain library of multiple uncharacterized proteins

    • Systematic phenotypic screening under various conditions (nutritional stress, DNA damage, meiotic induction)

    • Quantitative fitness measurements and genetic interaction mapping

  • Temporal coordination studies:

    • High-resolution time-course analysis during meiosis

    • Correlation of expression patterns with known meiotic events

    • Identification of co-regulated gene clusters

  • Evolutionary analysis:

    • Comparison with orthologs in related fission yeast species

    • Assessment of conservation levels across different domains

    • Identification of species-specific adaptations

  • Multi-omics integration:

    • Correlation of transcriptomic, proteomic, and metabolomic data

    • Network analysis to position SPBP19A11.02c in relevant pathways

    • Identification of unique regulatory signatures

  • Synthetic genetic interactions:

    • Synthetic genetic array (SGA) analysis

    • Targeted double mutant construction with known meiotic regulators

    • Chemical-genetic profiling to identify functional pathways

What are common challenges in recombinant expression of SPBP19A11.02c and how can they be addressed?

Researchers working with recombinant SPBP19A11.02c may encounter several technical challenges:

  • Protein insolubility:

    • Optimize expression temperature (try 18°C, 25°C, 30°C)

    • Use solubility-enhancing fusion partners (MBP, SUMO, Thioredoxin)

    • Test different buffer compositions with varying salt concentrations and pH

    • Consider mild detergents for membrane-associated proteins

  • Low expression yield:

    • Optimize codon usage for E. coli or alternative expression hosts

    • Test different E. coli strains (BL21, Rosetta, Arctic Express)

    • Consider S. pombe expression systems for authentic post-translational modifications

    • Use auto-induction media instead of IPTG induction

  • Protein instability:

    • Add protease inhibitors during purification

    • Include stabilizing agents (glycerol, trehalose, specific metal ions)

    • Optimize storage conditions (buffer composition, pH, temperature)

    • Consider flash-freezing aliquots to prevent freeze-thaw degradation

  • Functional characterization difficulties:

    • Ensure protein is properly folded using circular dichroism

    • Verify structural integrity through limited proteolysis

    • Develop activity assays based on predicted function

    • Use thermal shift assays to identify stabilizing conditions

How can researchers validate antibody specificity for SPBP19A11.02c studies?

Ensuring antibody specificity is critical for reliable SPBP19A11.02c research. A comprehensive validation protocol should include:

  • Preliminary validation:

    • Western blot against recombinant protein

    • Comparison of signal in wild-type vs. deletion strains

    • Pre-absorption test with purified antigen

  • Specificity controls:

    • Testing antibody against lysates from overexpression strains

    • Peptide competition assays

    • Screening against closely related proteins

  • Application-specific validation:

    • For immunoprecipitation: verification of pulled-down protein by mass spectrometry

    • For immunofluorescence: comparison with GFP-tagged protein localization

    • For ChIP: validation with tagged protein ChIP and appropriate controls

  • Cross-reactivity assessment:

    • Testing against lysates from related yeast species

    • Epitope mapping to identify potential cross-reactive regions

    • Dilution series to determine optimal working concentration

  • Documentation:

    • Detailed recording of antibody source, lot number, and validation experiments

    • Sharing validation data in publications and repositories

What emerging technologies might advance understanding of SPBP19A11.02c function?

Several cutting-edge technologies could significantly enhance our understanding of SPBP19A11.02c:

  • CRISPR-Cas9 applications:

    • Precise genome editing for functional domain mapping

    • CRISPRi for temporal knockdown studies

    • Base editing for introduction of specific mutations

    • Prime editing for precise sequence modifications

  • Advanced microscopy:

    • Super-resolution microscopy for detailed localization

    • Live-cell single-molecule tracking

    • Correlative light and electron microscopy (CLEM)

    • Lattice light-sheet microscopy for long-term imaging

  • Structural biology approaches:

    • Cryo-electron microscopy for protein structure determination

    • Integrative structural biology combining multiple data sources

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • AlphaFold2 and other AI-based structure prediction tools

  • Single-cell technologies:

    • Single-cell RNA-seq during meiotic progression

    • Single-cell proteomics for protein abundance measurement

    • Spatial transcriptomics for localization of expression

    • Multi-modal single-cell analysis

  • Systems biology approaches:

    • Multi-omics data integration

    • Network modeling of meiotic regulation

    • Perturbation analysis using combinatorial genetic modifications

    • Mathematical modeling of expression dynamics

How can contradictory data on SPBP19A11.02c function be reconciled in experimental design?

When facing contradictory data regarding SPBP19A11.02c function, researchers should implement systematic approaches to resolve discrepancies:

  • Standardization of experimental conditions:

    • Establish unified protocols for meiotic synchronization

    • Standardize growth conditions and media composition

    • Use consistent strain backgrounds for comparability

    • Implement precise timing for sample collection

  • Methodological cross-validation:

    • Apply multiple independent techniques to measure the same parameter

    • Validate observations across different experimental platforms

    • Compare results from different detection methods (antibody vs. tag-based detection)

    • Reproduce key findings in different laboratories

  • Genetic background considerations:

    • Test for strain-specific effects by using multiple S. pombe isolates

    • Construct clean genetic backgrounds to minimize confounding mutations

    • Consider heterogeneity in lab strains due to accumulated mutations

  • Context-dependent function analysis:

    • Systematically test function under different environmental conditions

    • Evaluate meiotic stage-specific activities

    • Investigate potential redundancy with other proteins

    • Analyze genetic interactions that may mask phenotypes

  • Meta-analysis approach:

    • Compile all available data with detailed experimental parameters

    • Weight evidence based on methodological rigor

    • Develop testable hypotheses that could explain apparent contradictions

    • Design decisive experiments targeting the most likely explanations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.