Recombinant Schizosaccharomyces pombe Uncharacterized protein P22H7.03 (pi028, SPBP22H7.03)

What expression systems are suitable for producing recombinant P22H7.03 protein?

Recombinant P22H7.03 has been successfully expressed in E. coli with an N-terminal His-tag . For expressing this S. pombe protein, researchers should consider the following methodological approaches:

• Bacterial Expression (E. coli): The documented successful expression in E. coli suggests this is a viable approach. Use pET-based vectors with T7 promoter systems and BL21(DE3) or Rosetta strain hosts for optimal expression.

• Yeast Expression Systems: Consider using S. pombe itself as an expression host for homologous expression, which may preserve native folding and post-translational modifications. Alternative yeast systems like S. cerevisiae or Pichia pastoris could also be considered.

• Mammalian Cell Expression: For studies requiring mammalian post-translational modifications, HEK293 or CHO cells can be utilized with vectors containing CMV promoters.

When choosing an expression system, consider the research questions being addressed. For structural studies or antibody production, E. coli expression might be sufficient, while functional studies may benefit from expression in yeast systems similar to how heterologous expression has been achieved with other S. pombe proteins .

What are the optimal purification and storage conditions for recombinant P22H7.03?

Based on the available information for recombinant His-tagged P22H7.03 protein, the following purification and storage protocols are recommended:

Purification Protocol:

• Express the His-tagged protein in E. coli

• Lyse cells in appropriate buffer (Tris or phosphate-based, pH 7.5-8.0)

• Purify using Ni-NTA affinity chromatography

• Consider a secondary purification step (ion exchange or size exclusion chromatography)

• Verify purity by SDS-PAGE (>90% purity should be achievable)

Storage Conditions:

• Store the purified protein as a lyophilized powder for long-term stability

• For working solutions, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 30-50% for freeze storage

• Store at -20°C/-80°C in small aliquots to avoid freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

It's important to note that repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and activity loss. For reconstitution, a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose has been successfully used .

What bioinformatic approaches can help predict the function of the uncharacterized P22H7.03 protein?

To predict potential functions of P22H7.03, researchers should employ a multi-tiered bioinformatic approach:

• Sequence Homology Analysis: Use BLAST, HMMER, and PSI-BLAST to identify distant homologs across species. Look particularly at other fungi and yeasts where functional homologs may be better characterized.

• Domain and Motif Prediction: Use InterProScan, SMART, and Pfam to identify conserved domains or functional motifs. The C-terminal region of P22H7.03 contains hydrophobic residues that may indicate membrane association.

• Secondary Structure Prediction: Tools like JPred, PSIPRED, and RaptorX can predict secondary structural elements that might offer functional clues.

• Subcellular Localization Prediction: Use TargetP, PSORT, and DeepLoc to predict the likely cellular compartment of P22H7.03.

• Protein-Protein Interaction Networks: Search databases like STRING and BioGRID for potential interaction partners based on genomic context or co-expression data.

• Gene Ontology Enrichment: Look for patterns in the functions of proteins that contain similar sequence elements or have similar expression profiles.

From the protein sequence analysis, the presence of hydrophobic regions in the C-terminal portion (ILTLILLSCGLLMLFIGYPILSAVEVEKQRKKN) suggests potential membrane association, which might be relevant to cell wall integrity pathways described in S. pombe .

What experimental approaches are recommended for characterizing the function of P22H7.03?

For functional characterization of P22H7.03, a comprehensive strategy involving multiple experimental approaches is recommended:

• Gene Knockout/Knockdown Studies:

  • Create P22H7.03 deletion mutants in S. pombe

  • Analyze phenotypic changes (growth rates, morphology, stress responses)

  • Compare with known phenotypes of other cell wall integrity proteins

• Localization Studies:

  • Generate GFP or fluorescent protein fusions

  • Perform colocalization studies with known compartment markers

  • Use immunofluorescence with antibodies against the recombinant protein

• Protein-Protein Interaction Studies:

  • Yeast two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity labeling techniques (BioID or APEX)

  • Test interactions with Rho GTPases and protein kinase C homologues (pck1p, pck2p) that are known to function in S. pombe cell integrity pathways

• Transcriptional Analysis:

  • RNA-seq to identify genes differentially expressed in knockout/knockdown strains

  • Compare expression patterns under different stress conditions

  • ChIP-seq if the protein is suspected to have DNA-binding properties

• Biochemical Activity Assays:

  • Test for enzymatic activities based on bioinformatic predictions

  • Assess potential roles in cell wall biosynthesis pathways

  • Investigate possible interactions with (1,3)β-D-glucan synthase components

This multi-faceted approach should provide convergent evidence for the function of P22H7.03 and place it within the broader context of S. pombe cellular processes.

How can researchers design experiments to test if P22H7.03 interacts with cell wall integrity pathway components?

To investigate potential interactions between P22H7.03 and the cell wall integrity pathway in S. pombe, researchers should design experiments based on known components of this pathway:

• Co-immunoprecipitation (Co-IP) Studies:

  • Create epitope-tagged versions of P22H7.03 and key pathway components (rho1p, rho2p, pck1p, pck2p)

  • Perform reciprocal Co-IP experiments using antibodies against these tags

  • Analyze precipitates by Western blotting or mass spectrometry

  • Include controls for specificity, such as using GTP-locked versions of Rho proteins

• Fluorescence Resonance Energy Transfer (FRET):

  • Generate fluorescent protein fusions (e.g., CFP-P22H7.03 and YFP-rho1p)

  • Measure energy transfer to detect direct protein-protein interactions in vivo

  • Include appropriate positive and negative controls

• Genetic Interaction Studies:

  • Create double mutants combining P22H7.03 deletion with mutations in cell wall integrity genes

  • Look for synthetic lethality, suppression, or enhancement of phenotypes

  • Test for genetic interactions with cps1+ and gls2+ (encoding membrane subunits of (1,3)β-D-glucan synthase)

• Biochemical Activity Assays:

  • Measure (1,3)β-D-glucan synthase activity in wild-type and P22H7.03 mutant strains

  • Separate enzyme activity into soluble and membrane fractions

  • Compare results to effects seen with pck1p and pck2p, which differentially affect this enzyme

• Response to Cell Wall Stress:

  • Expose wild-type and P22H7.03 mutant cells to cell wall stressors (e.g., Calcofluor White, Congo Red)

  • Compare phenotypes to those of strains with known defects in cell wall integrity

  • Monitor activation of cell wall integrity pathway signaling components

When designing these experiments, it's important to note that in S. pombe, both pck1p and pck2p interact with rho1p and rho2p specifically when these GTPases are in their GTP-bound active form, and this interaction occurs at the amino-terminal region containing HR1 motifs .

What techniques are available for analyzing potential post-translational modifications of P22H7.03?

To characterize potential post-translational modifications (PTMs) of P22H7.03, researchers should employ a combination of biochemical, mass spectrometry, and cell biology techniques:

• Mass Spectrometry-Based PTM Analysis:

  • Purify recombinant or endogenous P22H7.03 protein

  • Perform tryptic digestion followed by LC-MS/MS analysis

  • Use enrichment strategies for specific modifications:

    • Phosphopeptide enrichment using TiO2 or IMAC

    • Glycopeptide enrichment using lectin affinity

    • Ubiquitination analysis using K-ε-GG antibodies

• PTM-Specific Detection Methods:

  • Phosphorylation: Western blotting with phospho-specific antibodies; Phos-tag SDS-PAGE

  • Glycosylation: Periodic acid-Schiff (PAS) staining; lectin blotting

  • Ubiquitination/SUMOylation: Immunoprecipitation under denaturing conditions followed by Western blotting

• PTM Site Mutagenesis:

  • Generate point mutations at predicted or identified PTM sites

  • Create non-modifiable variants (e.g., S/T→A for phosphorylation)

  • Create phosphomimetic mutations (e.g., S/T→D/E)

  • Assess functional consequences of these mutations

• Dynamic PTM Analysis:

  • Monitor PTM changes under different cellular conditions or stresses

  • Use pulse-chase approaches to determine PTM turnover rates

  • Employ specific inhibitors of PTM-related enzymes

• PTM Interactome Analysis:

  • Identify proteins that interact specifically with modified forms of P22H7.03

  • Use modification-specific interactors as functional readouts

For membrane-associated proteins like P22H7.03 (suggested by its hydrophobic C-terminal region), special consideration should be given to extraction conditions that preserve membrane protein integrity while allowing access to PTM analysis tools.

How can researchers reconcile conflicting results about P22H7.03 function from different experimental approaches?

When faced with conflicting results regarding P22H7.03 function, researchers should apply a systematic troubleshooting and reconciliation approach:

• Experimental Validation and Reproducibility:

  • Verify that conflicting results can be independently reproduced

  • Standardize experimental conditions across different approaches

  • Consider biological versus technical replicates in statistical analyses

  • Ensure proper controls were included in all experiments

• Cross-Experimental Validation:

  • Validate key findings using orthogonal techniques

  • For example, confirm protein-protein interactions identified by yeast two-hybrid with co-immunoprecipitation

  • Verify knockout phenotypes using complementary approaches (gene deletion, RNAi, CRISPR interference)

• Context-Dependent Function Assessment:

  • Consider whether P22H7.03 might have different functions in different cellular contexts

  • Test function under various growth conditions, stress responses, or cell cycle stages

  • Examine potential moonlighting functions in different cellular compartments

• Protein Complex Analysis:

  • Determine if P22H7.03 functions as part of different protein complexes

  • Use size exclusion chromatography or blue native PAGE to identify native complexes

  • Apply proximity-dependent labeling to identify context-specific interaction partners

• Integrate Multiple Data Types:

  • Create a weighted evidence approach combining results from different methods

  • Consider the strengths and limitations of each technique

  • Develop computational models that account for apparent contradictions

• Experimental Design Table:

When reconciling conflicting data about P22H7.03, consider its potential involvement in cell wall integrity pathways, where redundancy between different components (like pck1p and pck2p) has been observed in S. pombe .

How can researchers design a CRISPR-based approach for studying P22H7.03 function in S. pombe?

Designing a CRISPR-based approach for studying P22H7.03 in S. pombe requires careful consideration of this organism's specific genetic toolkit:

• CRISPR System Selection:

  • Choose an appropriate CRISPR system (SpCas9 or more compact Cas9 variants)

  • Consider using a codon-optimized Cas9 for expression in S. pombe

  • Alternatively, use Cas12a/Cpf1 if targeting AT-rich regions

• Guide RNA Design:

  • Design multiple sgRNAs targeting P22H7.03 using S. pombe-specific CRISPR design tools

  • Verify target specificity through whole-genome off-target analysis

  • Consider targeting different functional domains predicted within P22H7.03

  • Optimal sgRNA design parameters:

• Delivery Methods:

  • Clone Cas9 and sgRNA into S. pombe expression vectors with appropriate promoters

  • Consider integrating Cas9 into the genome for stable expression

  • Use appropriate selection markers for S. pombe (e.g., ura4+, leu1+)

• Experimental Approaches:

  • Gene Knockout: Design sgRNAs with repair templates to create complete gene deletion

  • Point Mutations: Use HDR templates to create specific mutations in functional domains

  • CRISPRi: Use catalytically dead Cas9 (dCas9) fused to repressors for gene silencing

  • CRISPRa: Use dCas9 fused to activators to enhance expression

  • Live Tracking: Use dCas9 fused to fluorescent proteins for genomic locus visualization

• Validation Approaches:

  • Genomic PCR and sequencing to confirm intended modifications

  • RT-qPCR to verify expression changes

  • Western blotting to confirm protein level alterations

  • Phenotypic assays based on predicted functions (cell wall integrity, membrane stress)

• Controls and Rescue Experiments:

  • Include non-targeting sgRNA controls

  • Perform genetic complementation with wild-type P22H7.03

  • Create an sgRNA-resistant version of P22H7.03 for specificity validation

When implementing CRISPR in S. pombe, researchers should consider the genetic engineering techniques previously used for this organism, such as those employed for expressing heterologous genes from Ralstonia eutropha in S. pombe .

What are the most promising future research directions for understanding P22H7.03 function?

Based on the current knowledge of P22H7.03 and S. pombe biology, several promising research directions emerge:

• Integrated Multi-omics Approach: Combining transcriptomics, proteomics, and metabolomics data from P22H7.03 mutants could provide a systems-level understanding of its function.

• Evolutionary Functional Analysis: Comparative studies of P22H7.03 homologs across fungal species could reveal conserved functions and species-specific adaptations.

• Membrane Biology Connection: Given the hydrophobic C-terminal region of P22H7.03, investigating its potential role in membrane organization, trafficking, or cell wall synthesis pathways would be particularly valuable.

• Stress Response Pathway Integration: Examining how P22H7.03 functions under various stress conditions might reveal its role in cellular adaptation mechanisms.

• Protein Complex Identification: Defining the composition of any protein complexes containing P22H7.03 could provide important functional insights.

• Heterologous Expression Studies: Following the successful approach used with other S. pombe proteins, expressing P22H7.03 in different hosts might reveal functions not apparent in its native context.

The uncharacterized nature of P22H7.03 presents both challenges and opportunities for researchers. By applying rigorous experimental approaches and integrating findings across multiple techniques, researchers can contribute significantly to understanding this protein's role in S. pombe biology. The potential connection to cell wall integrity pathways, suggested by the structural features of P22H7.03 and the importance of these pathways in S. pombe , represents a particularly promising avenue for investigation.

How can findings about P22H7.03 contribute to our broader understanding of S. pombe biology?

Characterizing P22H7.03 has the potential to advance our understanding of S. pombe biology in several key areas:

• Cell Wall Integrity Pathways: If P22H7.03 interacts with known components like rho1p, rho2p, pck1p, or pck2p, it would expand our understanding of this essential signaling network that regulates cell wall synthesis and remodeling in response to environmental changes .

• Membrane Protein Biology: As a potential membrane protein, P22H7.03 characterization could reveal new aspects of membrane organization or trafficking in S. pombe.

• Model Organism Enhancement: S. pombe is an important model organism for studying eukaryotic cell biology. Expanding our understanding of its proteome through characterization of uncharacterized proteins like P22H7.03 strengthens its utility as a model system.

• Comparative Genomics: Functional annotation of P22H7.03 would contribute to cross-species comparisons between different yeast species, potentially revealing evolutionary adaptations in cellular processes.

• Biotechnological Applications: Understanding the complete protein complement of S. pombe supports its use in biotechnological applications, such as heterologous protein expression systems similar to those developed for producing polyhydroxyalkanotes .