Recombinant Schizosaccharomyces pombe Uncharacterized protein P27G11.14c (SPAP27G11.14c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPAP27G11.14c; Uncharacterized protein SPAP27G11.14c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-689
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAP27G11.14c
Target Protein Sequence
MNLLSHQLRDRFPIKAIISKADEVIFANYKHTNDFFKITATTYALINSVIVSNNCCNRRF HSTWQKKKHDDLTATVPVIDFRKNQKLTSIVVNAIQAIYWYARRSNCLTGINEAEYIWKS LIPESIFYHFVSLQSFIRKYLTDVFYCSAQKVILLSTDDSVVSSEKLYIRIASILSNAND KVSFKESSINTNTVFKDVYVEVSSHNDEFLLKNSSKCWAFTSLLVDPLHFMFSQIVFEDL SGKKIMKFEDTAVSTASNHSKQFTKGNLLAIKYIGGLYNAVYLMGLKKNLLAFVENEKDD LFVAKIFLLAYSSSKNRKKIVPVDVWDAMIDSLYETINVEETKKETYKFTRSIKTVIPNK LISNESISILSIPESEKTIYQNFDLYVSKFNVARKELSEKELFNNSFSSSFNTLLASLLV KPTLCLISYLMIAKKMVVLQEANRLFLKSFAHPFHLERYHLHAVAAMGGLYQIMSSTHLK NLFFCSRKGIALTKLHSQQYNESTLFQYLSEFVHQRQKSLTPKQRIAIQELILKFMQRNF ENSLYHQSFSSHWFISRLLINPIRMLCWHITDVGKTLDLGEAEKLLKYNHKQCPYIIYPS SLKAVQKLGGLQCIIRNDNLSHIFNCSRKYIRVQRYSDDDLSESSLLPRLVNLLLFFENS MGEVAWNKLSQTLMDMFEKETKSNSLSDY
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion.

Q&A

What is the optimal expression system for producing recombinant SPAP27G11.14c?

The current evidence indicates E. coli provides an effective heterologous expression system for SPAP27G11.14c. According to product specifications, successful expression has been achieved using an N-terminal 10xHis-tagged construct expressed in E. coli . For researchers planning expression experiments, consider:

  • Vector selection: Plasmids with strong inducible promoters (T7, tac) are recommended

  • Expression conditions: Initial optimization should test multiple temperatures (16°C, 25°C, 37°C), IPTG concentrations (0.1-1.0 mM), and induction times (3-24 hours)

  • Protein solubility: As a transmembrane protein, SPAP27G11.14c may require detergent solubilization or membrane fraction isolation procedures

For challenging expression scenarios, consider alternative systems such as the natural host (S. pombe) itself, as some fission yeast proteins express poorly in prokaryotic systems. S. pombe expression has proven successful for other recombinant proteins, including heterologous expression of bacterial genes .

What storage conditions maximize stability of purified SPAP27G11.14c?

Proper storage is critical for maintaining functional integrity of SPAP27G11.14c. The protein demonstrates optimal stability under these conditions:

  • Long-term storage: -20°C or -80°C in buffer containing 50% glycerol

  • Working aliquots: Store at 4°C for maximum of one week

  • Freeze/thaw cycles: Strictly avoid repeated freezing and thawing

  • Recommended buffer: Tris-based buffer optimized for this specific protein

The shelf life varies based on storage conditions:

  • Liquid form: approximately 6 months at -20°C/-80°C

  • Lyophilized form: approximately 12 months at -20°C/-80°C

These recommendations derive from empirical observations with this specific protein and should be strictly followed to prevent degradation or activity loss.

How can bioinformatic approaches help predict potential functions of SPAP27G11.14c?

Given its uncharacterized status, computational methods represent a critical starting point:

  • Sequence homology analysis: Perform BLAST searches against characterized proteins in multiple databases

  • Domain prediction: Use tools like Pfam, SMART, or InterPro to identify conserved functional domains

  • Structural prediction: Deploy AlphaFold2 or similar tools to generate structural models

  • Orthology mapping: Utilize HCOP (HGNC Comparison of Orthology Predictions) to identify potential orthologs in model organisms

A comprehensive approach should integrate multiple prediction methods, as illustrated in this workflow:

  • Generate multiple sequence alignments with both close and distant homologs

  • Identify conserved residues that may indicate functional sites

  • Predict secondary and tertiary structure

  • Map conserved residues onto structural models

  • Perform molecular docking simulations with potential ligands

  • Validate predictions experimentally (site-directed mutagenesis)

This systematic approach provides hypotheses that can guide focused experimental investigation.

What experimental design strategies are most effective for determining SPAP27G11.14c function in S. pombe?

A multi-faceted approach combining genetic, biochemical, and cellular methods provides the most robust framework:

Genetic Approaches:

  • CRISPR/Cas9 gene knockout or RNA interference to observe loss-of-function phenotypes

  • Overexpression studies to identify gain-of-function effects

  • Genetic screen for synthetic lethal or synthetic sick interactions

  • Conditional expression systems (e.g., regulated promoters)

Biochemical Approaches:

  • Immunoprecipitation coupled with mass spectrometry to identify binding partners

  • In vitro binding assays with potential substrates or interactors

  • Activity assays based on predicted biochemical functions

Cellular Approaches:

  • Subcellular localization studies using fluorescent protein fusions

  • Environmental stress response profiling (temperature, pH, nutrient limitation)

  • Cell cycle analysis and synchronization experiments

A particularly effective strategy would be to examine the protein's role in zinc metabolism, given S. pombe's well-characterized response to zinc deficiency . Design experiments to monitor SPAP27G11.14c expression and localization under zinc-limited conditions, and assess whether knockout strains display altered zinc homeostasis.

How should I design experiments to investigate SPAP27G11.14c's potential role in transmembrane transport?

Based on its predicted transmembrane nature, SPAP27G11.14c may function in transport processes. A systematic investigation would include:

Transporter Assays:

  • Generate proteoliposomes containing purified SPAP27G11.14c

  • Conduct flux assays with various substrates (ions, metabolites, etc.)

  • Measure transport kinetics under varying conditions (pH, temperature, etc.)

Biochemical Characterization:

  • Perform substrate binding assays using techniques such as isothermal titration calorimetry

  • Conduct competitive binding experiments to determine specificity

  • Analyze structural changes upon substrate binding using circular dichroism or fluorescence spectroscopy

Genetic Approaches:

  • Use S. pombe strains with SPAP27G11.14c deletion or overexpression

  • Assess growth phenotypes under various stress conditions

  • Measure intracellular concentrations of potential substrates

Experimental Controls:

  • Include known transporters as positive controls

  • Use empty liposomes or inactive mutants as negative controls

  • Verify protein orientation in proteoliposomes

Given S. pombe's response to zinc deficiency , special attention should be paid to testing zinc and related metal ions as potential substrates.

How can I systematically address protein-protein interactions involving SPAP27G11.14c?

A comprehensive protein interaction study should employ multiple complementary approaches:

In Vivo Methods:

  • Yeast two-hybrid screening using SPAP27G11.14c as bait

  • Proximity labeling approaches (BioID, APEX) in S. pombe

  • Co-immunoprecipitation followed by mass spectrometry

  • Fluorescence resonance energy transfer (FRET) with candidate partners

In Vitro Methods:

  • Pull-down assays with recombinant SPAP27G11.14c

  • Surface plasmon resonance or bio-layer interferometry to determine binding kinetics

  • Crosslinking mass spectrometry to identify interaction interfaces

Bioinformatic Approaches:

  • Prediction of interaction partners based on co-expression data

  • Evolutionary coupling analysis to identify potential interactors

  • Structural modeling of protein complexes

Validation Strategy:

  • Identify candidates through at least two independent methods

  • Confirm direct interactions using purified components

  • Map interaction domains through truncation or mutagenesis

  • Assess functional relevance by disrupting interactions in vivo

What approaches can elucidate the structure-function relationship of SPAP27G11.14c?

Understanding the relationship between protein structure and function requires integrated methodologies:

Structural Analysis:

  • X-ray crystallography or cryo-EM for high-resolution structure determination

  • NMR spectroscopy for dynamic regions and ligand interactions

  • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

  • Small-angle X-ray scattering (SAXS) for solution-state conformation

Functional Mapping:

  • Alanine scanning mutagenesis of conserved residues

  • Domain deletion or swapping experiments

  • Chimeric proteins with related homologs

  • Site-directed crosslinking to trap functional states

Computational Approaches:

  • Molecular dynamics simulations to identify functional motions

  • Sequence conservation mapping onto structural models

  • Energy minimization and ligand docking studies

  • Electrostatic surface analysis to identify potential binding sites

For transmembrane proteins like SPAP27G11.14c, special considerations include:

  • Detergent or nanodisc reconstitution for structural studies

  • Lipid composition effects on protein function

  • Membrane topology determination using accessibility studies

Table 1: Recommended Expression Conditions for Recombinant SPAP27G11.14c

ParameterPrimary RecommendationAlternative OptionsNotes
Expression SystemE. coli BL21(DE3)Rosetta(DE3), Arctic ExpressCodon optimization may improve yield
VectorpET series with N-terminal His-tagpGEX (GST-tag), pMAL (MBP-tag)Fusion partners may improve solubility
Induction Temperature18°C25°C, 30°CLower temperature reduces inclusion body formation
IPTG Concentration0.1 mM0.5 mM, 1.0 mMTitrate for optimal expression
Induction TimeOvernight (16h)4h, 6h, 24hMonitor by SDS-PAGE time course
MediaLB with glucoseTerrific Broth, Auto-inductionRich media may improve yield
Lysis Buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1% detergentVarious detergents (DDM, LDAO, etc.)Optimize detergent for protein stability

Table 2: Experimental Approaches for Functional Characterization

ApproachMethodologyExpected OutcomeLimitations
Gene DisruptionCRISPR/Cas9 knockoutPhenotypic changes indicating functionPotential redundancy masks phenotype
LocalizationGFP fusion expressed from native locusSubcellular compartment providing functional cluesTag may interfere with function
Interactome AnalysisIP-MS, BioIDNetwork of protein interactionsFalse positives, weak/transient interactions missed
Transcriptional ResponseRNA-seq under varied conditionsPathways affected by protein functionIndirect effects difficult to distinguish
Metabolomic AnalysisLC-MS/MS profilingMetabolic pathways affectedComplex data interpretation
Stress ResponseGrowth assays under various stressorsConditions where protein is essentialLabor-intensive, may miss subtle phenotypes
Zinc HomeostasisICP-MS metal quantificationChanges in cellular zinc handlingRequires specialized equipment

By systematically applying these methodologies, researchers can develop testable hypotheses about SPAP27G11.14c function and its role in S. pombe biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.