Recombinant Schizosaccharomyces pombe Uncharacterized protein PB17E12.11 (SPAPB17E12.11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ost3; SPAPB17E12.11; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3; Oligosaccharyl transferase 34 kDa subunit; Oligosaccharyl transferase subunit OST3; Oligosaccharyl transferase subunit gamma
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-309
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
ost3
Target Protein Sequence
KLDLNSKTDADGVIQITGRLFHRIVNGKQDFTTVALFSADSSTMNCDVCRLIEPEFKALA NSYKLKYGLDSGIRFTYADFGKNKNLFQDFSIESVPNFWIFKPKSIQAIHVDLSHGVTAS HLAAIVEKHTGKIADIVYKQDQAKRVGAFLSYIIVGAALFFTRKIIVKIFTSRKVWAALT IITVITLSSGYMFTRIRFSPYSQRGEHGENLWLAGSQQFQFGAEVQVVSLLYTALTMSSI FLAIVAPKVEGAKRQTLFVIIWLAFLWIGYSFLVDIFKRKVSMYPFKLLI
Uniprot No.

Target Background

Function

Recombinant Schizosaccharomyces pombe Uncharacterized protein PB17E12.11 (SPAPB17E12.11) is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation. N-glycosylation occurs co-translationally, and the OST complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for maximal enzyme activity.

Database Links
Protein Families
OST3/OST6 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Why is Schizosaccharomyces pombe an important model organism for studying this protein?

S. pombe serves as an excellent model organism for studying uncharacterized proteins like PB17E12.11 because approximately 70% of its genes have human orthologs, including many genes involved in human disease pathways . Its genome was fully sequenced in 2002, becoming the sixth eukaryotic organism to have its genome completely characterized . This fission yeast is particularly valuable for studying cellular processes relevant to human biology, including DNA damage responses and DNA replication . The extensive conservation between S. pombe and human proteins makes findings about PB17E12.11 potentially translatable to human health research.

How does the recombinant version of this protein differ from the native form?

The recombinant version of PB17E12.11 protein is typically produced with an N-terminal His-tag in E. coli expression systems . This differs from the native form in several key aspects:

CharacteristicNative PB17E12.11Recombinant PB17E12.11
Expression systemS. pombeE. coli
Protein taggingNo artificial tagsN-terminal His-tag
Post-translational modificationsNatural S. pombe modificationsLimited or absent eukaryotic modifications
Folding environmentEukaryotic cellular machineryProkaryotic cellular machinery
FormMembrane-associatedTypically purified as lyophilized powder

These differences must be considered when interpreting experimental results, as they may affect protein function, stability, and interaction capabilities.

What are the optimal experimental parameters for working with recombinant PB17E12.11 protein?

When working with recombinant PB17E12.11 protein, follow these methodological guidelines for optimal results:

  • Reconstitution: Briefly centrifuge the vial before opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage: Add glycerol to a final concentration of 5-50% (50% is recommended) and aliquot for long-term storage at -20°C or -80°C . Avoid repeated freeze-thaw cycles as they degrade protein quality. Working aliquots can be stored at 4°C for up to one week .

  • Buffer conditions: The protein is stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 , which should be considered when designing experiments to avoid buffer incompatibilities.

  • Quality control: Verify protein purity using SDS-PAGE (should be >90%) and consider activity assays specific to glycosyltransferases before proceeding with complex experiments.

  • Experimental controls: Always include appropriate positive and negative controls to validate experimental outcomes, especially when studying an uncharacterized protein.

How should I design experiments to determine the function of this uncharacterized protein?

Designing experiments to elucidate the function of PB17E12.11 requires a systematic approach:

  • Hypothesis formulation: Based on sequence homology suggesting oligosaccharyl transferase activity, formulate testable hypotheses about potential functions .

  • Variables identification: Define your independent variables (experimental conditions you'll manipulate) and dependent variables (outcomes you'll measure) .

  • Control setup: Implement both positive controls (known oligosaccharyl transferases) and negative controls (reaction mixtures lacking the protein) .

  • Treatment design: Create experimental treatments that manipulate your independent variables, such as substrate concentration, cofactor availability, or reaction conditions .

  • Subject assignment: If using cell models, assign subjects to groups using either between-subjects or within-subjects designs to minimize bias .

  • Measurement planning: Determine precise methods for measuring your dependent variables, such as product formation, substrate disappearance, or downstream cellular effects .

  • Confounding variable control: Identify and control potential confounding variables that might influence results, such as temperature fluctuations or contaminants .

  • Replication strategy: Plan for biological and technical replicates to ensure statistical power and reproducibility.

What methods are recommended for analyzing potential contradictions in research data related to this protein?

When faced with contradictory findings regarding PB17E12.11, employ these methodological approaches:

What genomic and proteomic approaches can reveal the biological role of PB17E12.11?

Understanding PB17E12.11's biological role requires integrated genomic and proteomic methodologies:

  • Comparative genomics: Analyze orthologous proteins across species to identify conserved domains and potential functions. With 70% of S. pombe genes having human orthologs, this approach can be particularly informative .

  • Gene knockout/knockdown: Generate PB17E12.11-deficient S. pombe strains using CRISPR-Cas9 or traditional homologous recombination techniques to observe phenotypic changes.

  • Protein localization: Building on prior S. pombe proteome-wide localization studies using GFP tags , determine the subcellular localization of PB17E12.11 to gain insights into its function.

  • Interactome analysis: Identify protein interaction partners through techniques such as:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Yeast two-hybrid screening

    • Proximity-dependent biotin identification (BioID)

    • Co-immunoprecipitation with tagged recombinant protein

  • Expression profiling: Analyze expression patterns of PB17E12.11 under various conditions using RNA-seq or microarray analysis to identify regulatory networks.

  • Post-translational modification mapping: Identify modifications such as phosphorylation, glycosylation, or ubiquitination that may regulate PB17E12.11 function.

  • Structural biology: Determine the 3D structure using X-ray crystallography, cryo-EM, or NMR to gain insights into functional domains and interaction surfaces.

How can researchers leverage S. pombe genome data to understand PB17E12.11 in the context of cellular pathways?

Researchers can exploit the well-characterized S. pombe genome to contextualize PB17E12.11 within cellular pathways:

  • Synteny analysis: Examine the genomic neighborhood of PB17E12.11 to identify functionally related genes, as genes in the same pathway are often clustered.

  • Transcriptional co-regulation: Identify genes with similar expression patterns to PB17E12.11 across different conditions, potentially revealing functional relationships.

  • Genetic interaction screening: Conduct systematic genetic interaction screens (e.g., synthetic lethality/sickness screens) to identify genes that functionally interact with PB17E12.11.

  • Chromatin structure analysis: Investigate chromatin structure and modifications around the PB17E12.11 gene to understand its regulation.

  • Regulatory motif identification: Analyze promoter regions for regulatory motifs that could provide insights into the conditions under which PB17E12.11 is expressed.

  • Evolutionary rate analysis: Compare evolutionary rates of PB17E12.11 across different yeast species to infer functional constraints and importance.

  • Integrating with Pfh1 binding data: Investigate potential relationships between PB17E12.11 and Pfh1 (an accessory replicative helicase in S. pombe), as Pfh1 binding sites have been identified across the S. pombe genome .

What are the most effective approaches for studying protein-protein interactions involving PB17E12.11?

To effectively study protein-protein interactions involving PB17E12.11, consider these methodological approaches:

  • Affinity-based methods:

    • Use His-tagged recombinant PB17E12.11 for pull-down assays

    • Develop specific antibodies for co-immunoprecipitation experiments

    • Employ tandem affinity purification (TAP) tagging for high-confidence interactions

  • Proximity-based methods:

    • BioID or TurboID for identifying neighboring proteins in living cells

    • APEX2 proximity labeling for subcellular compartment-specific interactions

    • Cross-linking mass spectrometry (XL-MS) to capture transient interactions

  • Genetic approaches:

    • Yeast two-hybrid screens with PB17E12.11 as bait

    • Suppressor screens to identify genetic interactors

    • Synthetic genetic array (SGA) analysis to map genetic interaction networks

  • Biophysical techniques:

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for quantitative interaction analysis

    • Fluorescence resonance energy transfer (FRET) for studying interactions in living cells

  • Computational predictions:

    • Structure-based docking simulations

    • Co-expression network analysis

    • Phylogenetic profiling to predict functional relationships

How should researchers interpret contradictory findings about PB17E12.11 across different studies?

When confronted with contradictory findings about PB17E12.11 across studies, researchers should follow this methodological framework:

  • Systematic comparison of methodologies: Create a detailed table comparing experimental approaches, conditions, and systems used in each study to identify methodological differences that might explain contradictions .

  • Context-dependent interpretation: Consider that PB17E12.11 may have different functions in different cellular contexts or under different experimental conditions .

  • Technical validation: Reproduce key experiments using standardized methods to determine if contradictions stem from technical variations or biological realities.

  • Integration with broader knowledge: Contextualize contradictory findings within the broader understanding of glycosyltransferases and oligosaccharyl transferase complexes.

  • Resolution framework: Apply a structured approach to resolving contradictions, considering:

    • Different protein isoforms or splice variants

    • Post-translational modifications affecting function

    • Cellular compartmentalization affecting activity

    • Temporal dynamics of protein function

    • Concentration-dependent effects

  • Bayesian reasoning: Apply Bayesian updating to revise confidence in various hypotheses as new evidence emerges, rather than viewing contradictions as binary conflicts.

What bioinformatics tools are most valuable for analyzing the structure and function of PB17E12.11?

For comprehensive bioinformatic analysis of PB17E12.11, researchers should utilize these tools and approaches:

  • Sequence analysis tools:

    • BLAST for identifying homologous proteins

    • HMMER for detecting remote homologs using hidden Markov models

    • MEME Suite for motif discovery

    • ConSurf for evolutionary conservation analysis

  • Structural prediction tools:

    • AlphaFold2 for 3D structure prediction

    • RoseTTAFold for alternative structural models

    • SWISS-MODEL for homology modeling

    • I-TASSER for integrated structure prediction

  • Functional annotation tools:

    • InterProScan for domain and functional site identification

    • Pfam for protein family classification

    • CATH/SCOP for structural classification

    • Gene Ontology (GO) analysis for functional categorization

  • Network analysis tools:

    • STRING for protein-protein interaction network prediction

    • Cytoscape for network visualization and analysis

    • PomBase for S. pombe-specific interaction data and annotation

  • Membrane protein analysis tools:

    • TMHMM for transmembrane helix prediction

    • SignalP for signal peptide prediction

    • PredGPI for GPI-anchor prediction

    • TOPCONS for membrane protein topology

  • Post-translational modification prediction:

    • NetPhos for phosphorylation sites

    • NetOGlyc/NetNGlyc for glycosylation sites

    • UbPred for ubiquitination sites

    • SUMOplot for SUMOylation sites

How can researchers optimize experimental repeatability when working with this uncharacterized protein?

Ensuring experimental repeatability with PB17E12.11 requires rigorous methodological controls:

  • Standardized protein preparation:

    • Maintain consistent expression systems and purification protocols

    • Implement quality control checkpoints (SDS-PAGE, mass spectrometry)

    • Document and control batch-to-batch variations

    • Use consistent reconstitution and storage procedures

  • Detailed protocol documentation:

    • Create comprehensive standard operating procedures (SOPs)

    • Record all experimental parameters, including buffer compositions, pH, temperature, and incubation times

    • Document equipment settings and calibration status

    • Use electronic lab notebooks for improved traceability

  • Reagent validation:

    • Validate antibodies for specificity using appropriate controls

    • Authenticate cell lines and strains

    • Use reference standards where possible

    • Track reagent lot numbers and expiration dates

  • Robust statistical approach:

    • Determine appropriate sample sizes through power analysis

    • Pre-register experimental designs and analysis plans

    • Apply appropriate statistical tests based on data distribution

    • Control for multiple comparisons when applicable

  • Independent verification:

    • Reproduce key findings using alternative methods

    • Have different researchers repeat critical experiments

    • Collaborate with independent laboratories for validation

    • Consider using different recombinant protein production systems

How might research on PB17E12.11 contribute to our understanding of human disease?

Research on PB17E12.11 has significant implications for human disease understanding:

  • Glycosylation disorders: As an oligosaccharyl transferase subunit , PB17E12.11 research could illuminate mechanisms underlying congenital disorders of glycosylation (CDGs), which cause developmental delays and multisystem dysfunction.

  • Cancer biology: Aberrant glycosylation is a hallmark of cancer cells. Understanding PB17E12.11's role in protein glycosylation could provide insights into cancer cell biology and potential therapeutic targets.

  • Neurodegenerative diseases: Protein glycosylation plays crucial roles in neurodevelopment and neurodegeneration. PB17E12.11 homologs in humans may be relevant to conditions like Alzheimer's or Parkinson's disease.

  • Infectious disease: Glycosylation affects host-pathogen interactions. Insights from PB17E12.11 could inform our understanding of infection mechanisms and immune responses.

  • Translational potential: With 70% of S. pombe genes having human orthologs , discoveries about PB17E12.11 could directly translate to human biology and disease mechanisms.

What are the emerging technologies that could accelerate research on uncharacterized proteins like PB17E12.11?

Several cutting-edge technologies are poised to transform research on uncharacterized proteins:

  • AI-driven structure prediction: AlphaFold2 and similar tools have revolutionized protein structure prediction, allowing researchers to generate high-confidence structural models of uncharacterized proteins like PB17E12.11.

  • Single-cell technologies: Single-cell transcriptomics and proteomics enable the study of protein function with unprecedented cellular resolution, revealing cell type-specific roles.

  • Spatial transcriptomics/proteomics: These technologies map gene and protein expression within tissues, potentially revealing localization patterns that inform function.

  • CRISPR-based functional genomics: High-throughput CRISPR screens can systematically evaluate gene function across various conditions, accelerating functional characterization.

  • Proximity proteomics: Techniques like TurboID enable rapid mapping of protein neighborhoods in living cells, revealing functional associations.

  • Cryo-electron tomography: Advances in cryo-ET allow visualization of proteins in their native cellular environment, providing insights into in vivo function.

  • Microfluidics-based assays: High-throughput microfluidic platforms enable rapid testing of protein function across numerous conditions simultaneously.

  • Machine learning for functional prediction: Advanced algorithms can integrate diverse data types to predict protein function with increasing accuracy.

What interdisciplinary approaches would be most fruitful for comprehensively characterizing PB17E12.11?

Comprehensive characterization of PB17E12.11 would benefit from these interdisciplinary approaches:

  • Structural biology + computational biology: Combining experimental structure determination with computational modeling to predict functional sites and interaction partners.

  • Genetics + proteomics: Integrating genetic manipulation of the ost3 gene with proteomic profiling to observe system-wide effects.

  • Glycobiology + systems biology: Merging glycan analysis with network modeling to understand PB17E12.11's role in the glycosylation pathway ecosystem.

  • Evolutionary biology + molecular biology: Studying orthologs across species to track functional conservation and specialization, informing experimental design.

  • Biophysics + cell biology: Combining biophysical characterization of protein properties with cellular localization and trafficking studies.

  • Synthetic biology + biochemistry: Engineering synthetic systems to test hypothesized functions in controlled environments, complemented by detailed biochemical analysis.

  • Data science + experimental biology: Using machine learning to identify patterns across large datasets and guide targeted experimental validation.

  • Medicinal chemistry + structural biology: Designing small molecule probes based on structural insights to perturb and study protein function in vivo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.