Recombinant Schizosaccharomyces pombe Uncharacterized protein PB8E5.10 (SPAPB8E5.10)

Shipped with Ice Packs
In Stock

Description

Gene Identification and Nomenclature

The protein SPAPB8E5.10 is annotated in Schizosaccharomyces pombe (fission yeast) genome databases but remains poorly characterized. Its systematic name (SPAPB8E5.10) follows the standard fission yeast nomenclature, where "SPAPB" denotes the chromosome (Pb), "8E5" specifies the genomic region, and "10" identifies the gene within that region.

Expression Profile

SPAPB8E5.10 has been studied in the context of meiotic gene regulation. During meiosis, it shows moderate mRNA accumulation (74.10 units) and low Pol II occupancy (1.24 units), suggesting limited transcriptional activity in non-meiotic conditions .

ParameterSPAPB8E5.10
mRNA accumulation (0 h)74.10
Pol II occupancy1.24
mRNA/Pol II ratio59.73

Data derived from meiotic gene expression profiling .

Putative Roles

While no direct functional studies exist for SPAPB8E5.10, its meiotic expression profile suggests potential involvement in:

  • Chromatin dynamics: Fission yeast meiosis involves extensive chromatin remodeling, often mediated by uncharacterized proteins .

  • RNA metabolism: SPAPB8E5.10 may interact with components of the RNA processing machinery, as seen in related proteins like Rrp12 (SPAPB8E5.07c.1) .

Sequence Analysis

SPAPB8E5.10 lacks homologs in model organisms (e.g., Saccharomyces cerevisiae, Homo sapiens), based on sequence similarity searches. This suggests a potential S. pombe-specific function.

Expression and Purification

Recombinant production of SPAPB8E5.10 has not been documented in the literature. General challenges for uncharacterized S. pombe proteins include:

  • Low solubility: Fission yeast proteins often require specialized buffers (e.g., glycerol additives) .

  • Stability: Lyophilized forms typically have a 12-month shelf life at -20°C/-80°C, but empirical validation is needed .

Functional Assays

Hypothetical approaches to study SPAPB8E5.10 include:

  1. Yeast two-hybrid screens to identify interaction partners.

  2. CRISPR-Cas9 knockout to assess phenotypic effects in meiosis or vegetative growth.

  3. Biochemical assays (e.g., ATPase activity, RNA-binding) if sequence motifs suggest enzymatic functions.

Unresolved Questions

  • Biological function: No evidence links SPAPB8E5.10 to specific pathways (e.g., DNA repair, transcriptional regulation).

  • Post-translational modifications: Phosphorylation or ubiquitination patterns remain unexplored.

Comparative Genomics

Fission yeast has distinct nucleosome positioning and histone modification patterns compared to budding yeast . SPAPB8E5.10’s role in these processes, if any, remains speculative.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing your order. We will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
SPAPB8E5.10; Uncharacterized protein PB8E5.10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-73
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAPB8E5.10
Target Protein Sequence
MAVLSRIMKPYRAFQRLPFELKPLAILIGIAGSTAIFTMGYKIYSDPEIRRSPSWVAQTQ QKEETKVKKPQFH
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Uncharacterized protein PB8E5.10?

Schizosaccharomyces pombe Uncharacterized protein PB8E5.10 (SPAPB8E5.10) is a protein encoded in the genome of fission yeast (S. pombe strain 972 / ATCC 24843) with Uniprot accession number Q9C0X5 . The protein contains 73 amino acids with an expression region of 1-73, making it a relatively small protein with currently undefined function . Bioinformatic analyses suggest potential membrane association based on its amino acid sequence, which includes hydrophobic regions consistent with transmembrane domains. Despite being annotated as "uncharacterized," preliminary structural predictions indicate potential roles in cellular processes that require further experimental validation.

How should researchers store and handle recombinant SPAPB8E5.10?

For optimal maintenance of protein integrity, recombinant SPAPB8E5.10 should be stored in Tris-based buffer with 50% glycerol at -20°C, with long-term storage at -80°C recommended . Repeated freeze-thaw cycles should be avoided to prevent protein degradation, with working aliquots maintained at 4°C for up to one week to minimize structural changes and activity loss . When preparing the protein for experiments, researchers should consider:

  • Using non-binding plastic tubes to prevent protein adherence to container walls

  • Including appropriate protease inhibitors in working solutions

  • Performing activity assays after storage to confirm functional integrity

  • Documenting batch variations by running quality control SDS-PAGE gels

For experiments requiring extended protein stability, additional stabilizing agents may be necessary based on the specific experimental design requirements.

What experimental designs are most appropriate for characterizing the function of SPAPB8E5.10?

For rigorous functional characterization of SPAPB8E5.10, a completely randomized design approach provides a solid foundation for initial experiments . This experimental strategy should incorporate multiple treatment conditions with appropriate controls to identify potential functions. A randomized block design is particularly valuable when handling variables that might confound experimental outcomes, such as different S. pombe strains or growth conditions .

Consider this experimental approach for functional characterization:

Experimental GroupTreatmentReplicatesControlsReadout
Wild-type S. pombeStandard conditions5Media-onlyGrowth rate, morphology
SPAPB8E5.10 knockoutStandard conditions5Wild-typeGrowth rate, morphology
SPAPB8E5.10 overexpressionStandard conditions5Empty vectorGrowth rate, morphology
Stress conditions (multiple)Various stressors5 eachUnstressed cellsSurvival, stress response

The factorial design approach would be particularly valuable for assessing protein function under varying environmental conditions, allowing researchers to evaluate how SPAPB8E5.10 responds to different stressors, nutrients, or genetic backgrounds simultaneously .

How can researchers effectively express and purify recombinant SPAPB8E5.10?

Effective expression and purification of recombinant SPAPB8E5.10 requires careful optimization based on the protein's biochemical properties. The recommended expression approach involves:

  • Expression system selection: E. coli BL21(DE3) for standard expression, or eukaryotic systems like S. cerevisiae for proper post-translational modifications if required.

  • Vector design: Incorporate an appropriate fusion tag (His6, GST, or MBP) to facilitate purification and potentially enhance solubility, with a precision protease cleavage site for tag removal.

  • Expression conditions: Optimize temperature (typically 16-25°C for membrane-associated proteins), IPTG concentration (0.1-1.0 mM), and induction time (4-16 hours) through small-scale expression trials.

  • Purification protocol:

    • Perform affinity chromatography using tag-specific resin

    • Include a second purification step (ion exchange or size exclusion)

    • Verify purity through SDS-PAGE and Western blotting

    • Confirm protein identity using mass spectrometry

For membrane-associated proteins like SPAPB8E5.10, inclusion of appropriate detergents during extraction and purification steps is critical for maintaining native conformation and preventing aggregation.

What controls should be included when studying SPAPB8E5.10?

Rigorous experimental design for SPAPB8E5.10 research requires multiple control types to ensure valid and reproducible results . Essential controls include:

  • Negative controls:

    • Empty vector-transformed cells for expression studies

    • Wild-type S. pombe strains without genetic manipulation

    • Buffer-only samples for binding and activity assays

  • Positive controls:

    • Well-characterized proteins with similar cellular localization

    • Known interaction partners for validation of binding assays

    • S. pombe strains with characterized phenotypes in genetic interaction studies

  • Experimental validation controls:

    • Technical replicates (minimum 3) to assess method reproducibility

    • Biological replicates (minimum 3) to account for natural variation

    • Dose-response controls for interaction studies

In randomized block experimental designs, these controls should be distributed across blocks to minimize systematic bias and account for experimental variation .

What approaches should researchers use to identify potential interaction partners of SPAPB8E5.10?

Identifying interaction partners for an uncharacterized protein like SPAPB8E5.10 requires a multi-faceted approach combining both in vivo and in vitro methodologies:

  • Yeast two-hybrid screening: Using SPAPB8E5.10 as bait against an S. pombe cDNA library to identify direct protein-protein interactions.

  • Co-immunoprecipitation with mass spectrometry: Expressing tagged SPAPB8E5.10 in S. pombe, followed by affinity purification and MS analysis of co-purified proteins.

  • Proximity-based labeling: BioID or APEX2 fusion proteins to identify proximal proteins in living cells, particularly valuable for membrane-associated proteins.

  • Crosslinking mass spectrometry: Using chemical crosslinkers to capture transient interactions followed by MS identification.

  • Computational prediction: Leveraging bioinformatic tools to predict interaction partners based on sequence conservation, structural modeling, and co-expression data.

Data from these complementary approaches should be integrated to generate a high-confidence interaction network, with follow-up validation experiments designed to confirm the biological relevance of identified interactions.

How can researchers investigate the cellular localization of SPAPB8E5.10?

Determining the subcellular localization of SPAPB8E5.10 provides critical insights into its potential function. A comprehensive localization study should include:

  • Fluorescent protein fusion constructs: Creating N- and C-terminal GFP/mCherry fusions of SPAPB8E5.10 for live-cell imaging, ensuring fusion proteins remain functional.

  • Immunofluorescence microscopy: Using antibodies against the native protein or epitope tags when direct fusion might disrupt localization.

  • Subcellular fractionation: Biochemical separation of cellular compartments followed by Western blot analysis to detect SPAPB8E5.10 distribution.

  • Co-localization studies: Simultaneous visualization of SPAPB8E5.10 with known organelle markers to precisely define its subcellular distribution.

  • Electron microscopy: Immunogold labeling for ultra-high resolution localization, particularly valuable for membrane proteins.

Given SPAPB8E5.10's sequence characteristics, special attention should be paid to membrane compartments, with differential detergent extraction protocols to distinguish between peripheral and integral membrane associations.

What bioinformatic approaches can predict the function of SPAPB8E5.10?

For uncharacterized proteins like SPAPB8E5.10, computational methods provide valuable function predictions to guide experimental design:

  • Sequence homology analysis: Identifying distant homologs across species using sensitive methods like PSI-BLAST and HMM-based approaches.

  • Structural prediction and modeling: Using AlphaFold2 or RoseTTAFold to generate structural models, followed by structural similarity searches against characterized proteins.

  • Domain and motif identification: Scanning for functional domains, transmembrane regions, signal peptides, and post-translational modification sites.

  • Gene neighborhood analysis: Examining conservation of genomic context across related species to identify functionally related genes.

  • Co-expression network analysis: Identifying genes with similar expression patterns across multiple conditions.

  • Protein-protein interaction prediction: Using machine learning approaches to predict potential binding partners based on sequence features.

The integration of these complementary computational approaches can generate testable hypotheses about SPAPB8E5.10 function that guide subsequent experimental validation.

How should researchers analyze protein-protein interaction data for SPAPB8E5.10?

Analysis of protein-protein interaction data for SPAPB8E5.10 requires robust statistical approaches and validation strategies:

  • Statistical filtering of high-throughput data: Apply appropriate statistical methods to distinguish genuine interactions from background noise in techniques like affinity purification-mass spectrometry (AP-MS).

  • Network analysis: Construct interaction networks with confidence scoring, centrality measures, and cluster analysis to identify functional modules.

  • Integration with orthogonal datasets: Combine interaction data with gene expression, phenotypic, and localization data to enhance confidence in biological relevance.

  • Visualization techniques: Generate network diagrams using platforms like Cytoscape for visual interpretation of complex interaction landscapes.

For quantitative interaction studies, researchers should employ statistical designs that account for experimental variability . A randomized block design approach is particularly valuable when comparing interaction profiles across different experimental conditions, as it controls for batch effects and technical variations .

What experimental design approaches should researchers use for genetic interaction studies with SPAPB8E5.10?

Genetic interaction studies require careful experimental design to yield interpretable results about SPAPB8E5.10 function:

  • Randomized complete block design: For comparing phenotypes of SPAPB8E5.10 mutants across different genetic backgrounds or conditions .

  • Factorial design: To systematically evaluate interactions between SPAPB8E5.10 and other genes across multiple conditions, allowing researchers to distinguish between additive and synergistic effects .

  • High-throughput screening design: For systematic genetic interaction mapping using technologies like synthetic genetic arrays (SGA) or CRISPR interference screens.

Statistical analysis of genetic interaction data should include:

Analysis ApproachApplicationStatistical Test
Quantitative growth measurementGrowth rate comparisonANOVA with post-hoc tests
Synthetic lethality analysisBinary interaction scoringFisher's exact test
Continuous interaction scoresInteraction strength measurementModified t-tests with FDR correction
Epistasis analysisPathway orderingRegression modeling

The incorporation of appropriate controls, randomization, and replication is essential for robust experimental design in genetic interaction studies .

What are common challenges in working with SPAPB8E5.10, and how can researchers address them?

Researchers working with uncharacterized proteins like SPAPB8E5.10 often encounter specific challenges that require methodological solutions:

  • Low expression yields: Optimize codon usage for the expression system, adjust induction conditions, or explore fusion partners like MBP or SUMO that enhance solubility.

  • Protein instability: Identify stabilizing buffer conditions through differential scanning fluorimetry, incorporate appropriate protease inhibitors, and use freshly prepared protein for sensitive assays.

  • Non-specific binding in interaction studies: Implement more stringent washing conditions, include competing proteins like BSA, and validate interactions through multiple orthogonal techniques.

  • Inconsistent phenotypes in genetic studies: Increase biological replicates, standardize growth conditions, and implement randomized block designs to control for batch effects .

  • Difficult subcellular localization: Try multiple tagging strategies (N-terminal, C-terminal, and internal tags) and validate with biochemical fractionation approaches.

For each challenge, a systematic approach to experimental design optimization will yield more reliable and reproducible results.

How can researchers design mutation studies to understand SPAPB8E5.10 structure-function relationships?

Structure-function analysis through targeted mutations provides valuable insights into SPAPB8E5.10's biological role:

  • Mutation design strategy:

    • Alanine scanning of conserved residues

    • Charge-reversal mutations at key positions

    • Domain swapping with homologous proteins

    • Truncation series to identify functional domains

  • Experimental validation approaches:

    • Complementation assays in knockout strains

    • Localization studies of mutant proteins

    • Interaction profiling of variant forms

    • Activity assays based on phenotypic readouts

  • Data analysis framework:

    • Correlation of structural features with functional outcomes

    • Statistical comparison of mutant vs. wild-type properties

    • Integration with computational structural models

A completely randomized design can be implemented when testing multiple mutations, while a randomized block design helps control for environmental variables that might affect phenotypic readouts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.