Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf10 (wtf10)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Schizosaccharomyces pombe Uncharacterized Protein wtf10 (wtf10) is a heterologously expressed protein derived from the fission yeast Schizosaccharomyces pombe. This protein belongs to the wtf gene family, which includes meiotic drivers and suppressors that influence gamete survival during sporulation . The recombinant form enables biochemical and functional studies of wtf10’s dual roles in spore killing (poison) and rescue (antidote) .

Gene and Protein Overview

  • Gene Name: wtf10 (synonyms: wtf7, SPCC1183.10) .

  • UniProt ID: O74838 .

  • Protein Length: 258 amino acids .

Production and Purification

Recombinant wtf10 is produced in diverse expression systems, with standardized protocols ensuring high purity:

ParameterDetails
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells, or Cell-Free Expression .
Purity≥85% (SDS-PAGE) .
TagHis tag (N-terminal) for affinity purification .
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose; avoid freeze-thaw cycles .

Role in Meiotic Drive

  • Poison-Antidote System: wtf10 encodes both a poison protein (toxic to spores lacking the wtf10 allele) and an antidote protein (rescues wtf10-bearing spores) .

  • Transcriptional Regulation:

    • Poison Transcript: Controlled by the Mei4 transcription factor, expressed early in meiosis .

    • Antidote Transcript: Produced later, ensuring antidote delivery only to spores inheriting wtf10 .

  • Localization: Poison aggregates localize to all spores, while antidote selectively accumulates in wtf10-positive spores .

Suppressor Activity

  • wtf10 can act as a meiotic drive suppressor, neutralizing toxins from other wtf genes .

Experimental Use Cases

  • Meiotic Drive Studies: Used to dissect spore-killing mechanisms in S. pombe .

  • Protein Interaction Assays: Identified interactions with other wtf proteins and regulators like Mei4 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
wtf10; wtf7; SPCC1183.10; Meiotic drive suppressor wtf10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
wtf10
Target Protein Sequence
MKNNCTSLKSSIDEEDELKTDHEIDLEKGLLPEYDSKEEGALPLYSDHARLSNSPNTHRE NNPSRSTDNSSPLLIKLLISFTSIILFNAPAVCYLKYKDAFFKNYGAAEWTLFGFWCLVC TLALIFLTYFYETWTKAVKVTVIFLAQCVKACGKGIKHFLKKWENMPMAFSEVFLFNIFG GALRIISRHFFGKRWGLKCSLADHIIFAILSILVFIAETVKPGSIRVNLIRKMGHEAKQQ VNEYTAIPLHEMNPESEA
Uniprot No.

Target Background

Function

Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf10 (wtf10): This protein functions as a suppressor component within the dual wtf meiotic drive system. It can suppress meiotic drive induced by compatible poisons but does not confer drive itself. Wtf meiotic drive systems promote unequal allele transmission from the parental zygote to progeny spores. This is achieved by encoding a poison and an antidote at the same locus. The poison acts trans-actingly, forming toxic aggregates in all spores within an ascus. The antidote, however, is spore-specific and targets these aggregates for vacuolar degradation. Consequently, meiotic drive via wtf systems results in the poisoning of progeny lacking the dual poison/antidote allele or the expression of a compatible antidote.

Database Links
Protein Families
WTF family
Subcellular Location
Spore membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the wtf10 protein and what is its role in S. pombe?

Wtf10 (also known as wtf7, SPCC1183.10, or Meiotic drive suppressor wtf10) is a member of the wtf (with transposon fission yeast) gene family in Schizosaccharomyces pombe. The wtf gene family includes both meiotic drivers and drive suppressors, offering a tractable model system for studying selfish genetic elements . While many wtf genes function as meiotic drivers that destroy spores not inheriting the driver, wtf10 specifically has been characterized as a meiotic drive suppressor, potentially counteracting the action of driver wtf genes . The protein consists of 258 amino acids and, like other wtf family members, may be involved in the complex genetic conflicts that occur during meiosis in fission yeast .

How does wtf10 relate to other members of the wtf gene family?

The wtf gene family in S. pombe is remarkably diverse, with natural isolates containing between 4-14 predicted killer meiotic drivers . While many wtf genes function as classic selfish genetic elements that kill gametes not inheriting them (through a poison-antidote system), wtf10 appears to have evolved as a suppressor of this meiotic drive . This functional diversity within the gene family represents an evolutionary arms race between drivers and suppressors. The relationship between wtf10 and other family members illustrates the complex dynamics of intragenomic conflict, where some genes evolve to promote their own transmission while others evolve to restore fair segregation.

How do wtf meiotic drivers achieve their selective advantage, and how might wtf10 function as a suppressor?

Wtf meiotic drivers utilize a dual protein system to gain a transmission advantage. They encode both a Wtf poison protein that kills spores and a Wtf antidote protein that rescues spores inheriting the driver gene . These proteins are produced from two transcripts with largely overlapping coding sequences but using alternative transcriptional start sites. After meiosis in wtf driver heterozygotes, the Wtf poison is found in all spores, while the Wtf antidote is enriched in those that inherit the wtf driver .

As a potential suppressor, wtf10 might function by several mechanisms: it could interfere with the expression of driver wtf genes, neutralize poison proteins without requiring the specific antidote, or compete for cellular factors needed for driver function. Research methodologies to investigate these hypotheses would include:

  • Co-expression studies of wtf10 with known driver wtf genes

  • Protein interaction assays to detect binding between Wtf10 and driver proteins

  • Transcriptional analysis to determine if wtf10 affects expression of driver genes

  • Spore viability assays in strains with varying combinations of drivers and wtf10

What experimental approaches can be used to study the transcriptional regulation of wtf10?

To investigate wtf10 transcriptional regulation, researchers should consider these methodologies:

  • Promoter Analysis: Clone the putative promoter region of wtf10 upstream of a reporter gene (e.g., GFP) to identify regulatory elements.

  • Transcription Factor Binding Studies: Perform chromatin immunoprecipitation (ChIP) assays to identify transcription factors that bind to the wtf10 promoter. Research has shown that the Mei4 transcription factor, a master regulator of meiosis, controls the expression of some wtf transcripts , so this would be a candidate to investigate for wtf10 regulation.

  • Transcriptional Start Site Mapping: Use 5' RACE (Rapid Amplification of cDNA Ends) to precisely map the transcriptional start sites of wtf10, particularly to determine if it produces multiple transcripts like other wtf genes.

  • Expression Profiling: Monitor wtf10 expression through the cell cycle and meiosis using RT-qPCR or RNA-seq to identify temporal patterns.

  • Mutational Analysis: Create targeted mutations in the promoter region to identify specific regulatory elements.

What are the challenges in studying protein-protein interactions involving Wtf10?

Investigating protein-protein interactions for Wtf10 presents several methodological challenges:

  • Membrane Association: Based on its amino acid sequence, Wtf10 likely contains transmembrane domains (evidenced by hydrophobic stretches in its sequence), making it difficult to study using traditional interaction methods .

  • Expression Systems: While recombinant Wtf10 can be produced in E. coli , this prokaryotic system may not provide appropriate post-translational modifications or protein folding for a eukaryotic membrane protein.

  • Functional Redundancy: The presence of multiple wtf family members (4-14 in natural isolates) may create redundancy that complicates interpretation of interaction studies .

To address these challenges, researchers should consider:

  • Using split-ubiquitin yeast two-hybrid systems specifically designed for membrane proteins

  • Employing proximity labeling techniques like BioID or APEX in the native S. pombe environment

  • Developing S. pombe-specific expression systems for co-immunoprecipitation studies

  • Using CRISPR-Cas9 to tag endogenous Wtf10 for in vivo interaction studies

What are the optimal conditions for expressing and purifying recombinant Wtf10 protein?

For optimal expression and purification of recombinant Wtf10 protein:

Expression System:

  • E. coli has been successfully used for expressing full-length Wtf10 (1-258 aa) with an N-terminal His tag .

  • Consider using specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)).

Expression Conditions:

  • Induce at lower temperatures (16-20°C) to improve folding of membrane proteins.

  • Use lower IPTG concentrations (0.1-0.5 mM) for induction.

  • Extended induction times (16-24 hours) may improve yield.

Purification Protocol:

  • Lyse cells using methods suitable for membrane proteins (sonication with detergents).

  • Solubilize using mild detergents (DDM, LDAO, or Triton X-100).

  • Purify using Ni-NTA affinity chromatography under native conditions.

  • Consider size exclusion chromatography as a second purification step.

Storage Recommendations:

  • Store in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 .

  • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles.

  • For working stocks, add glycerol to 50% final concentration .

How can researchers effectively visualize Wtf10 localization in S. pombe cells?

To visualize Wtf10 localization in S. pombe:

  • GFP Tagging Strategies:

    • C-terminal GFP tagging has been successful for other Wtf family proteins (e.g., Wtf7, Wtf15) .

    • Use a flexible linker (GGGGS)x3 between Wtf10 and GFP to minimize interference with function.

    • Consider both N- and C-terminal tagging approaches, as the orientation may affect functionality.

  • Microscopy Approaches:

    • Confocal microscopy with z-stacking is recommended for 3D visualization.

    • For co-localization studies, combine with markers such as nsp1-mCherry (nucleoporin marker) .

    • Use time-lapse imaging during meiosis and sporulation to track dynamic changes in localization.

  • Image Processing:

    • Apply linear unmixing to distinguish true GFP signal from autofluorescence.

    • Use Gaussian blur for smoothing images when appropriate .

    • Adjust brightness and contrast for optimal visualization, but maintain consistent settings when comparing different samples.

  • Controls and Validation:

    • Confirm that the GFP-tagged Wtf10 retains functionality through complementation assays.

    • Include appropriate markers for subcellular compartments (nucleus, ER, Golgi, plasma membrane).

    • Perform immunofluorescence with anti-Wtf10 antibodies to validate GFP tagging results.

What methods can be used to study the dual transcriptional regulation of wtf genes, and can these be applied to wtf10?

Based on research with other wtf genes, the following methodologies can be adapted to study wtf10 transcriptional regulation:

  • Transcript Isoform Analysis:

    • Use Northern blotting to identify distinct transcript sizes.

    • Employ 5' RACE to map transcription start sites for potential poison and antidote transcripts.

    • Perform RT-PCR with primers specific to alternative 5' regions to quantify different isoforms.

  • Promoter Characterization:

    • Create reporter constructs with various lengths of the 5' regulatory region to identify minimal promoter elements.

    • Use site-directed mutagenesis to test specific regulatory elements.

    • Investigate the role of the Mei4 transcription factor, which has been shown to control expression of wtf poison transcripts in other wtf genes .

  • Chromatin Analysis:

    • Perform ChIP-seq to identify transcription factor binding sites in the wtf10 promoter regions.

    • Use ATAC-seq to assess chromatin accessibility at different stages of meiosis.

    • Map nucleosome positioning to identify regulatory regions.

  • Transcriptional Timing:

    • Synchronize S. pombe cultures and collect samples throughout meiosis.

    • Use RT-qPCR to quantify expression levels of potential poison and antidote transcripts over time.

    • Compare with expression patterns of known meiosis-specific genes.

Based on findings from other wtf genes, differential timing of poison and antidote transcript expression is likely a key mechanism for ensuring efficient drive .

How can researchers distinguish between wtf10's role as a suppressor versus other potential functions?

To determine if wtf10 functions primarily as a meiotic drive suppressor versus other potential roles:

  • Genetic Interaction Analysis:
    Create a matrix of genetic crosses between S. pombe strains with:

    • wtf10 deletion

    • wtf10 overexpression

    • Various known wtf drivers (wtf4, etc.)

    Strain CombinationExpected Phenotype if SuppressorAlternative Phenotype
    wtf10Δ × Wild-typeNormal spore viabilityDecreased viability if essential
    wtf10Δ × wtf4+Enhanced drive by wtf4No change if unrelated
    wtf10-OE × wtf4+Reduced drive by wtf4No change if unrelated
    wtf10-OE × Wild-typeNormal spore patternAltered pattern if other function
  • Molecular Mechanism Analysis:

    • Perform RNA-seq to identify genes affected by wtf10 presence/absence

    • Use protein interaction studies to determine if Wtf10 directly binds to driver proteins

    • Examine localization patterns to see if Wtf10 co-localizes with driver proteins

  • Evolutionary Analysis:

    • Compare wtf10 sequences across different S. pombe isolates

    • Calculate selection pressure (dN/dS) to identify signs of positive selection

    • Construct phylogenetic trees of wtf family members to understand wtf10's evolutionary history

What experimental controls are essential when studying the effects of recombinant Wtf10 protein in vitro?

When studying recombinant Wtf10 protein effects in vitro, include these critical controls:

  • Protein Quality Controls:

    • Size exclusion chromatography to confirm proper folding and absence of aggregation

    • Circular dichroism to assess secondary structure

    • Thermal shift assays to evaluate stability

    • Western blotting with anti-His antibodies to confirm full-length expression

  • Negative Controls:

    • Heat-denatured Wtf10 protein to distinguish specific from non-specific effects

    • Buffer-only samples to control for buffer components

    • Unrelated proteins with similar properties (size, charge, tags) to control for general protein effects

  • Positive Controls:

    • Other characterized Wtf family proteins (if available)

    • Known interacting partners in binding assays

  • Concentration Controls:

    • Dose-response experiments with multiple concentrations of Wtf10

    • Comparison with estimated physiological concentrations in S. pombe

  • Tag Effect Controls:

    • Compare His-tagged versus untagged versions to assess tag interference

    • Test multiple tag positions (N-terminal vs. C-terminal) to ensure functionality

How can researchers resolve contradictory data regarding wtf10 function compared to other wtf family members?

When facing contradictory results about wtf10 function versus other wtf family members:

  • Strain Background Analysis:

    • Different S. pombe isolates contain distinct wtf repertoires (4-14 members)

    • Test wtf10 function in multiple strain backgrounds

    • Create isogenic strains differing only in wtf10 status

  • Functional Redundancy Assessment:

    • Perform combinatorial gene deletions to identify potential compensatory mechanisms

    • Use RNA interference to knockdown multiple wtf genes simultaneously

    • Create forced heterozygotes with marked wtf alleles to track transmission

  • Contextual Analysis:

    • Test wtf10 function under varying environmental conditions

    • Examine effects at different stages of meiosis

    • Consider interaction with the host's meiotic machinery, particularly Mei4 transcription factor

  • Technical Approach Diversification:

    • Employ both in vivo and in vitro methodologies

    • Use multiple protein tags and reporter systems

    • Apply both genetic and biochemical approaches to the same question

  • Structural Considerations:

    • Develop structural models of Wtf10 versus other Wtf proteins

    • Identify key functional domains through chimeric proteins

    • Use targeted mutagenesis to test specific residues

What are promising approaches to study the structural biology of Wtf10 protein?

Given the challenges of membrane protein structural studies, researchers should consider:

  • Cryo-EM Approaches:

    • Use detergent micelles or nanodiscs to stabilize Wtf10 in solution

    • Consider fusion proteins (e.g., T4 lysozyme) to increase size and provide crystal contacts

    • Apply single-particle analysis for structure determination

  • Crystallography Strategies:

    • Screen multiple detergents and lipid cubic phase methods

    • Create truncated constructs focusing on soluble domains

    • Use antibody fragments to stabilize flexible regions

  • NMR Studies:

    • Focus on individual domains using recombinant fragments

    • Use selective isotope labeling to study specific interactions

    • Apply solid-state NMR for membrane-embedded regions

  • Computational Approaches:

    • Use AlphaFold or RoseTTAFold to predict structural models

    • Perform molecular dynamics simulations to study membrane interactions

    • Develop homology models based on related proteins with known structures

How might high-throughput methodologies advance our understanding of wtf10 and related meiotic drivers?

High-throughput approaches offer significant potential for wtf gene family research:

  • CRISPR Screens:

    • Systematically mutate wtf10 to identify functional domains

    • Screen for genetic interactions with other wtf genes

    • Create libraries of wtf10 variants to study evolutionary adaptability

  • Proteomics Approaches:

    • Use BioID or APEX proximity labeling to identify the Wtf10 interactome

    • Perform quantitative proteomics across meiotic stages

    • Apply protein arrays to study interactions with other cellular factors

  • Next-Generation Sequencing Applications:

    • RNA-seq to study global effects of wtf10 manipulation

    • ChIP-seq to identify genomic binding sites of Wtf proteins

    • Single-cell sequencing to capture cell-to-cell variability in wtf expression

  • High-Content Imaging:

    • Automated microscopy to track Wtf10 localization in large populations

    • Multi-color imaging to study co-localization with other cellular components

    • Live-cell imaging to capture dynamic behaviors during meiosis

What are the broader implications of wtf10 research for understanding selfish genetic elements?

Research on wtf10 and the wtf gene family provides valuable insights into:

  • Evolutionary Dynamics of Selfish Elements:

    • The wtf family represents an excellent model for studying rapid evolution of selfish genetic elements

    • Understanding suppressors like wtf10 helps explain how genomes maintain integrity despite selfish element proliferation

    • The diversity of wtf genes (4-14 per genome) illustrates the arms race between drivers and suppressors

  • Mechanisms of Meiotic Drive:

    • The dual poison-antidote system of wtf genes represents a sophisticated molecular strategy for drive

    • Transcriptional regulation by meiotic factors like Mei4 demonstrates how selfish elements can hijack host processes

    • Differential protein localization to developing spores shows spatial regulation of drive mechanisms

  • Genome Architecture and Conflicts:

    • S. pombe with its wtf genes provides a tractable model for studying intragenomic conflict

    • The challenge of evolving or maintaining transcriptional silencing of poison wtf genes illustrates constraints on host defense mechanisms

    • The wtf gene family demonstrates how genetic conflicts shape genome content and structure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.