Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf12 (wtf12)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The recombinant wtf12 protein is synthesized as a full-length polypeptide chain comprising 197 amino acids (1-197aa) with an N-terminal His-tag for purification. Key structural and biochemical properties include:

PropertyDetails
Gene Namewtf12 (Synonyms: SPCC1281.09, SPCC622.21)
Molecular Weight~22 kDa (calculated)
Amino Acid SequenceBegins with MKNNYTSLKSSVDEEDELKTGHEIDLEKG... ends with NSDTAIPLREMNPESEA
Expression SystemEscherichia coli (E. coli)
Purification TagN-terminal His-tag
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Expression Systems and Production

While S. pombe is a well-established host for eukaryotic protein expression due to its ability to perform post-translational modifications , wtf12 is produced in E. coli for cost-effective, high-yield synthesis. Key steps include:

  • Cloning: The wtf12 gene is amplified and cloned into expression vectors optimized for E. coli .

  • Induction: Protein expression is induced under controlled conditions, followed by cell lysis and affinity chromatography using nickel-NTA resin for His-tag purification .

  • Yield: Typical yields range between 0.1–1.0 mg/mL after reconstitution .

Functional and Biological Insights

Although wtf12 is classified as "uncharacterized," phylogenetic and genomic analyses suggest potential roles in meiosis or cellular stress responses. Notably:

  • Meiotic Drive Connection: wtf genes in S. pombe encode dual-function proteins (poison-antidote systems) that manipulate gamete survival during meiosis . While direct evidence for wtf12’s role in this process is lacking, its structural homology to other Wtf proteins implies functional parallels .

  • Localization: Wtf family proteins often localize to spore membranes or vesicles, hinting at roles in cellular trafficking or signaling .

Research Applications

Recombinant wtf12 is primarily used in:

  • Antibody Production: Serves as an immunogen for generating antibodies targeting fission yeast proteins .

  • Structural Studies: Facilitates crystallography or NMR to resolve its 3D architecture .

  • Functional Screens: Used in protein interaction assays (e.g., yeast two-hybrid) to identify binding partners .

Challenges and Future Directions

  • Functional Elucidation: The lack of annotated domains in wtf12 complicates mechanistic studies. Knockout strains or CRISPR-based screens in S. pombe could clarify its biological role .

  • Post-Translational Modifications: Future production in S. pombe (instead of E. coli) may enable studies requiring phosphorylation or glycosylation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
wtf12; SPCC1281.09; SPCC622.21; Uncharacterized protein wtf12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
wtf12
Target Protein Sequence
MKNNYTSLKSSVDEEDELKTGHEIDLEKGPLPEHNSEGESTLPPYSDISKLANLVPEDSS TGPTETANPNVERRQEFKDLHPNIYSLLRLLIAVLAVSVVFFTAWGCVNPLEKSTFGKIA FFVLIGLTCLILLITMILEPGLIGISIMKRLIGDNGNDERDYFVENRLLSSPDCDARQHA NSDTAIPLREMNPESEA
Uniprot No.

Target Background

Database Links
Protein Families
WTF family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How does wtf12 relate to other wtf family proteins in S. pombe?

The wtf12 protein belongs to the larger wtf gene family in S. pombe, which includes other characterized members such as wtf13, wtf7, and wtf15. These proteins function as meiotic drivers with high gamete-killing efficiency . Research indicates that wtf family members display dramatic diversity but share the common trait of efficient gamete-killing. Some members, like wtf7-GFP and wtf15-GFP, have been visualized as being expressed in spores . When comparing wtf12 with wtf13, there are notable structural differences - wtf13 is significantly larger at 418 amino acids compared to wtf12's 197 amino acids , suggesting potentially different functional domains despite belonging to the same protein family.

What are the optimal conditions for reconstituting lyophilized Recombinant wtf12 protein?

For optimal reconstitution of lyophilized Recombinant wtf12 protein, follow this methodological approach:

  • Centrifuge the vial briefly before opening to ensure all content settles at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is standard for long-term storage)

  • Aliquot the reconstituted protein for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles, as this degrades protein quality

  • For working stocks, store aliquots at 4°C for no more than one week

The reconstituted protein maintains stability in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How should researchers design true experimental approaches to study wtf12 function?

When designing true experimental approaches to study wtf12 function, researchers should incorporate these key elements:

  • Independent and dependent variables: The independent variable would be the presence/absence or manipulation of wtf12, while dependent variables might include meiotic efficiency, spore viability, or protein localization.

  • Control and experimental groups: Establish both experimental groups (containing wtf12 manipulations) and control groups (without manipulations) to isolate the specific effects of wtf12 .

  • Pretesting and posttesting: Measure outcomes before and after experimental manipulations to quantify changes.

The most robust approach would include:

  • Creating deletion strains (Δwtf12) to study loss-of-function effects

  • Developing overexpression systems to study gain-of-function effects

  • Generating tagged versions (e.g., wtf12-GFP) to study localization similar to approaches used for wtf7 and wtf15

  • Performing quantitative fitness analysis (QFA) under different nutrient conditions to determine environmental influences on wtf12 function

Researchers should consider that withholding certain conditions might be detrimental to cellular function, in which case a comparison group design may be more appropriate than a strict control group .

How can Quantitative Fitness Analysis (QFA) be applied to study wtf12's role under varying nutrient conditions?

Quantitative Fitness Analysis (QFA) offers a powerful high-throughput approach to assess wtf12's function across different nutrient environments:

Methodology:

  • Generate wtf12 deletion strains using the S. pombe deletion library

  • Culture strains initially in liquid YES (rich media) at 30°C

  • Spot cultures onto solid agars with different nutrient compositions:

    • YES (rich complex media)

    • EMM2 (minimal media with ammonium chloride)

    • EMMG (minimal media with glutamate)

    • EMMP (minimal media with proline as poor nitrogen source)

  • Compare growth rates and fitness between wild-type and Δwtf12 strains

  • Quantify fitness differences to determine if wtf12 contributes to adaptation under specific nutrient conditions

This approach has successfully identified non-essential genes whose deletion alters cell fitness under changing nutritional conditions. Researchers can extend this methodology by adding TOR pathway inhibitors like Torin1 to test if wtf12 interacts with nutrient-sensing pathways .

What techniques can be employed to study potential interactions between wtf12 and transcription elongation machinery?

To investigate potential interactions between wtf12 and transcription elongation machinery in S. pombe:

  • Co-immunoprecipitation (Co-IP) with tagged wtf12 to identify binding partners, particularly focusing on components of transcription complexes like the Super Elongation Complex (SEC)

  • Chromatin Immunoprecipitation (ChIP) using tagged wtf12 to identify genomic binding sites and determine if wtf12 associates with actively transcribed regions

  • RNA-seq analysis comparing wild-type and Δwtf12 strains to identify differentially expressed genes, particularly those involved in key cellular processes like cell separation

  • Genetic interaction screens crossing Δwtf12 with mutants of transcription factors like Ell1, Eaf1, and Ebp1 to identify synthetic phenotypes that suggest functional relationships

If wtf12 interacts with transcription machinery, researchers should systematically investigate its relationship with the rudimentary S. pombe SEC complex that includes Ell1, Eaf1, and Ebp1 .

How should researchers approach contradictory data when analyzing wtf12 localization patterns?

When confronted with contradictory data regarding wtf12 localization:

  • Verify tagging approach: Ensure that protein tagging hasn't disrupted localization signals or protein function by comparing N-terminal vs. C-terminal tags and different fluorescent proteins

  • Cross-validate with multiple techniques: Compare data from:

    • Fluorescence microscopy (as used for wtf7-GFP and wtf15-GFP)

    • Subcellular fractionation followed by Western blotting

    • Immunogold electron microscopy for higher resolution

  • Consider developmental timing: Wtf proteins show developmental regulation during meiosis and sporulation. Contradictory localization data might result from examining different developmental stages

  • Environmental influences: Test if localization changes under different nutrient conditions (YES vs. EMM2) or stress conditions

  • Statistical analysis: Apply rigorous statistical methods to quantify localization patterns across multiple cells and experiments

TechniqueAdvantagesLimitationsBest Application
GFP-taggingLive cell imaging, dynamic studiesMay affect protein functionInitial localization screening
ImmunofluorescenceNo tag required, endogenous proteinFixation artifactsConfirmation of GFP data
Subcellular fractionationBiochemical validationDisrupts cellular architectureQuantitative distribution analysis
Electron microscopyNanometer resolutionComplex sample preparationPrecise localization within organelles

What statistical approaches are most appropriate for analyzing wtf12 expression data across different experimental conditions?

For robust statistical analysis of wtf12 expression data:

  • For RT-qPCR data:

    • Normalize expression to multiple reference genes (at least 3) that maintain stability under your experimental conditions

    • Apply the ΔΔCt method with appropriate propagation of errors

    • Use ANOVA with post-hoc tests for multiple condition comparisons

    • Report effect sizes alongside p-values

  • For RNA-seq data:

    • Apply DESeq2 or edgeR for differential expression analysis

    • Use appropriate multiple testing correction (FDR)

    • Implement variance stabilizing transformations before clustering

    • Validate key findings with RT-qPCR

  • For protein quantification:

    • Normalize to total protein or stable reference proteins

    • Use linear mixed effects models to account for technical and biological variability

    • Apply non-parametric tests if normality assumptions are violated

When integrating data from multiple experiments:

  • Consider meta-analysis approaches

  • Use standardized effect sizes rather than p-values

  • Implement Bayesian methods to incorporate prior knowledge about wtf family proteins

What are the common pitfalls in purifying active Recombinant wtf12 protein and how can they be overcome?

Common Challenges and Solutions:

  • Protein insolubility:

    • Challenge: Wtf12 contains transmembrane domains that may cause aggregation

    • Solution: Optimize expression conditions (lower temperature, reduced induction), add solubilizing agents (0.1% Triton X-100), or use specialized E. coli strains

  • Low expression yield:

    • Challenge: Codon bias between S. pombe and E. coli

    • Solution: Use codon-optimized synthetic genes or E. coli strains with rare tRNA supplementation

  • Protein degradation:

    • Challenge: Proteolytic cleavage during expression/purification

    • Solution: Include protease inhibitors, use E. coli strains lacking key proteases (BL21), purify at 4°C

  • His-tag accessibility:

    • Challenge: Tag may be buried within protein structure

    • Solution: Try C-terminal tagging or increase imidazole concentration gradually during washing steps

  • Protein misfolding:

    • Challenge: Incorrect disulfide bond formation

    • Solution: Express in the presence of chaperones or use bacterial strains designed for disulfide bond formation

For maximum stability after purification, store the protein in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, and add glycerol to 50% for long-term storage at -20°C/-80°C .

How can researchers effectively visualize wtf12 localization during meiosis and sporulation?

To effectively visualize wtf12 localization during meiosis and sporulation:

  • Construct selection:

    • Create C-terminal GFP fusions similar to those used for wtf7-GFP and wtf15-GFP

    • Ensure the tag doesn't disrupt meiotic functions by verifying normal sporulation efficiency

  • Meiotic induction:

    • Use nitrogen starvation to synchronize cells and induce meiosis

    • For optimal visualization, collect samples at defined time points (0h, 4h, 8h, 12h, 24h)

  • Co-localization markers:

    • Include nucleoporin markers like nsp1-mCherry to provide structural context

    • Consider additional markers for ER, Golgi, or plasma membrane to determine precise localization

  • Imaging optimization:

    • Apply deconvolution or structured illumination microscopy for improved resolution

    • Use Gaussian blur for image smoothing as described for wtf7/wtf15 visualization

    • Adjust brightness and contrast appropriately for different cellular compartments

  • Analysis approaches:

    • Perform linear unmixing to separate fluorophore signals when using multiple tags

    • Quantify signal intensity across developmental stages

    • Track protein movement using time-lapse microscopy

When analyzing results, compare wtf12 localization patterns with other wtf family members to identify shared or unique properties that might explain their functions as meiotic drivers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.