Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf18 (wtf18)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant wtf18

Recombinant wtf18 is produced by expressing the wtf18 gene (synonyms: wtf5, SPCC285.07c) in heterologous systems such as E. coli, yeast, baculovirus, or mammalian cells . The protein is uncharacterized in terms of canonical enzymatic or structural roles but is implicated in modulating meiotic drive dynamics through poison-antidote interactions .

Key Features:

  • Amino Acid Sequence: Full-length protein (361 residues) with a sequence starting with MKNNYTSLKS... and ending with ...EAESE .

  • Isoforms: Produces long transcripts (antidote-like) but lacks short poison transcripts, distinguishing it from other wtf drivers .

  • Post-Translational Modifications: No glycosylation or phosphorylation sites reported; purity ≥85% as confirmed by SDS-PAGE .

Dual Transcriptional Regulation:

  • Unlike canonical wtf drivers (e.g., wtf4), wtf18 lacks a short poison transcript and instead produces only long antidote-like transcripts .

  • Acts as a suppressor of other wtf drivers (e.g., wtf13) by mimicking antidote activity through shared sequence homology .

Allelic Variants:

  • wtf18-2 Allele: Contains a seven-amino-acid insertion in exon 6 and shares 92% identity with the poison isoform of wtf13, enhancing its suppressor efficacy .

  • Functional Impact: The exon 6 sequence determines antidote specificity; wtf18-2 neutralizes wtf13 poison, restoring fertility in heterozygous diploids .

Key Studies:

  1. Suppression Mechanism:

    • wtf18-2 suppresses wtf13-mediated spore killing by producing antidote proteins that bind and neutralize wtf13 poison .

    • Transmission bias experiments showed 96% survival of spores carrying wtf18-2 in wtf13 heterozygotes .

  2. Recombination and Diversification:

    • Artificial recombination between wtf18 and wtf23 generated a chimeric driver (wtfC4) with novel poison-antidote specificity, highlighting wtf genes' evolutionary plasticity .

  3. Transcriptional Control:

    • wtf18 expression is independent of Mei4, a transcription factor critical for poison transcript regulation in other wtf genes .

Applications in Genetic Research

  • Model for Meiotic Drive: Used to study poison-antidote interactions and suppressor evolution .

  • Tool for Synthetic Biology: Chimeric wtf constructs (e.g., wtfC4) enable exploration of genetic conflict mechanisms .

  • Antibody Production: Rabbit polyclonal antibodies against wtf18 are available for ELISA and Western blot applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference for your convenience.
Shelf Life
The shelf life of our products depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms exhibit a 12-month shelf life at the same temperatures.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be finalized during production. If you have a preferred tag type, please communicate it to us and we will prioritize its development.
Synonyms
wtf18; wtf5; SPCC285.07c; Meiotic drive suppressor wtf18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
wtf18
Target Protein Sequence
MKNNYTSLKSPLDEEDELKTDHEIDLEKGLLPEYNSEEEGTLPLYSDISKLANPVPEDSS TGPTEIANPNVERRQEFKDSHPNIYFLLRLLISVLAVSVVFFTAWVCVNPLEKSIFGKVA FSVTIGITCPILFIATFCFFETWTQAVAQCIKVTVIFLAQCVKVTAVFLAKCVKVIAVGL YNSKKDLVVTIWLAWVVICFILFGCVKDGRLNLNKALICSTCSISAALFFILLLVCIPIW TLKHMLFGLFQVLGVQSCVVIVTKGLMYLFDKHIDATGYEIEASSLFVIGNFLFFYEMEC PGALKRMPKFIRNGIASFLEGIGNAFGGIGNAIGRIGNAFRGANDNNNNIPLEETEAESE V
Uniprot No.

Target Background

Function
This protein acts as a suppressor component within the dual wtf meiotic drive system. While it can suppress the meiotic drive induced by compatible poisons, it cannot confer drive itself. Wtf meiotic drive systems facilitate unequal transmission of alleles from the parental zygote to progeny spores by encoding a poison and an antidote from the same locus. The poison, which acts in a trans manner, forms toxic aggregates within all spores of an ascus. Conversely, the antidote exhibits spore-specific activity, targeting these aggregates for degradation via the vacuole. Consequently, meiotic drive driven by wtf systems results in the poisoning of all progeny that do not inherit the dual poison/antidote allele or express a compatible antidote.
Database Links
Protein Families
WTF family
Subcellular Location
Spore membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein.

Q&A

What is wtf18 and how does it relate to other wtf family proteins?

Wtf18 is a member of the wtf (with transposon fission yeast) gene family found in Schizosaccharomyces pombe. Like other characterized wtf genes, wtf18 likely functions as a meiotic driver that increases its own transmission to offspring by eliminating meiotic products (spores) that don't inherit it. The wtf gene family includes 4-14 members in different S. pombe isolates, with each isolate containing a unique complement of wtf drivers . While specific data on wtf18 is limited, it likely shares the dual protein production mechanism observed in characterized family members like wtf4, encoding both poison and antidote proteins from alternative transcriptional start sites .

What cellular mechanisms enable wtf proteins to function as meiotic drivers?

Wtf meiotic drivers operate through a poison-antidote system. Using wtf4 as the model example, the mechanism involves:

  • Expression of a poison protein that forms toxic aggregates packaged into all developing spores

  • Expression of an antidote protein that co-assembles with the poison in spores that inherit the wtf gene

  • Neutralization of the poison by the antidote, likely by promoting trafficking of poison aggregates to the vacuole

The poison protein kills spores that don't inherit the wtf gene, while the antidote protein protects spores that do inherit it. This mechanism ensures >90% transmission of the wtf driver from heterozygotes, which would otherwise show 50% transmission under Mendelian segregation .

How are wtf proteins transcriptionally regulated?

Wtf proteins utilize dual transcriptional regulation, which is critical for their function as meiotic drivers. In the characterized wtf4 gene:

  • The poison transcript is controlled by the Mei4 transcription factor, a master regulator of meiosis

  • The antidote transcript is produced from an alternative transcriptional start site with distinct regulatory control

  • Transcriptional timing ensures the poison is expressed before most of the antidote, exposing all spores to the poison while only spores inheriting the wtf gene receive sufficient antidote

This sophisticated transcriptional regulation likely applies to wtf18 and other family members, allowing them to effectively drive despite host attempts at suppression.

What experimental approaches are recommended for characterizing the regulatory elements of wtf18?

For characterizing wtf18 regulatory elements, researchers should consider:

  • Promoter analysis using reporter constructs to identify critical cis-regulatory elements controlling expression of both poison and antidote transcripts

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to wtf18 regulatory regions

  • Time-course RNA-seq during meiosis to measure expression dynamics of wtf18 poison and antidote transcripts

  • CRISPR-based promoter editing to mutate potential Mei4-binding sites or other regulatory elements

  • Heterologous expression systems to test sufficiency of identified regulatory elements

For accurate phenotypic assessment, constructs should be integrated at the endogenous locus or at a neutral site with proper controls. Based on wtf4 studies, fluorescent protein tagging at both N- and C-termini may be necessary to capture the full expression pattern of wtf18 protein variants .

How do the protein structures of wtf poisons and antidotes determine their functionality?

While specific structural data for wtf18 is not available, research on other wtf family members suggests:

  • Wtf poison proteins form toxic aggregates that are packaged into all developing spores

  • Wtf antidote proteins co-assemble with their cognate poisons, likely altering their aggregation properties

  • The poison-antidote interaction leads to trafficking to the vacuole rather than exerting toxicity

For wtf18 characterization, researchers should:

  • Generate fluorescently tagged versions at both N- and C-termini to track protein localization

  • Perform protein-protein interaction studies to identify antidote-poison binding domains

  • Conduct mutagenesis to identify key residues required for poison toxicity and antidote rescue

  • Assess protein stability and half-life of both poison and antidote forms during meiosis

  • Compare sequence homology with characterized wtf proteins to predict functional domains

What factors influence the evolutionary dynamics of wtf18 in natural populations?

The evolutionary success of wtf genes, including potentially wtf18, depends on several factors:

FactorDescriptionImpact on wtf Spread
Mating patternsFrequency of outcrossing vs. inbreedingHigher outcrossing rates accelerate wtf spread
Inbreeding coefficientMeasure of preferential mating between related cellsValues between -1 and 1; values closer to -1 maximize wtf spread
Population densityNumber of cells in proximity during matingMay affect mating partner selection
Fitness costsAdditional negative effects beyond spore killingCan slow or prevent wtf spread if costs are high
Antidote suppressorsPresence of genes encoding only antidote proteinsCan neutralize specific wtf drivers
Driver saturationNumber of existing wtf drivers in the genomeMay limit introduction of new drivers due to fertility impacts

Modeling indicates that even with the significant inbreeding observed in natural S. pombe isolates, wtf drivers can still spread through populations as long as some outcrossing occurs . This explains why all assayed S. pombe isolates contain multiple wtf drivers despite their fitness costs to heterozygotes.

What fluorescent tagging strategies are recommended for visualizing wtf18 expression and localization?

Based on research with wtf4, comprehensive visualization of wtf18 requires:

  • N-terminal tagging with mCherry to visualize the antidote protein

  • C-terminal tagging with GFP to visualize the poison protein

  • Additional C-terminal mCherry tagging of the antidote to reveal potentially overlooked protein populations

For optimal results:

  • Generate separation-of-function alleles that express only poison or only antidote to verify functionality

  • Use time-lapse microscopy to track protein expression timing throughout meiosis

  • Verify that tagged proteins retain meiotic drive functionality

  • Compare expression dynamics in both homozygous and heterozygous genetic backgrounds

  • Consider implementing photoactivatable fluorescent proteins to track protein movement during spore development

Studies of wtf4 revealed that C-terminal tagging identified an additional population of antidote protein not detected with N-terminal tagging alone, suggesting complex expression dynamics that might also apply to wtf18 .

How can genetic assays be designed to measure wtf18 drive efficiency?

To measure wtf18 drive efficiency:

  • Generate heterozygous diploids containing wtf18 and a wtf18Δ allele

  • Induce meiosis and sporulation

  • Measure viable spore yield (VSY) - the proportion of spores that survive

  • Genotype surviving spores to determine transmission rate of wtf18

Expected results for an efficient driver:

  • VSY will be approximately 50% (half the spores are killed)

  • Transmission of wtf18 will approach 100% among surviving spores

A comprehensive drive assay should:

  • Compare transmission rates in different genetic backgrounds

  • Test drive efficiency under various environmental conditions

  • Measure potential interactions with other wtf genes

  • Assess the influence of different mating types on drive efficiency

  • Compare results from laboratory and natural isolate backgrounds

What approaches can be used to identify potential suppressors of wtf18 drive?

To identify potential suppressors of wtf18 drive:

  • Screen natural isolates for variable wtf18 drive efficiency

  • Perform genetic crosses between strains with different drive phenotypes

  • Map genetic loci associated with reduced drive using bulk segregant analysis

  • Test candidate wtf antidote-only genes for suppression activity

  • Perform targeted mutagenesis of wtf18 to identify variants resistant to suppression

Researchers should note that S. pombe isolates contain between 8 and 17 suppressors of drive that encode only Wtf antidote proteins . These suppressors may cross-neutralize different wtf drivers based on sequence similarity, making it essential to test suppression across multiple wtf family members.

What experimental strategies could determine if wtf18 functionality depends on Mei4 transcription factor regulation?

To test Mei4 dependence of wtf18:

  • Generate mei4Δ strains and assess wtf18 poison transcript levels

  • Create reporter constructs with wtf18 poison and antidote promoters to test Mei4 dependence

  • Perform ChIP experiments to detect Mei4 binding at the wtf18 locus

  • Mutate potential Mei4 binding sites in the wtf18 promoter and measure effects on expression

  • Compare wtf18 expression timing with other Mei4-dependent genes during meiosis

This is particularly important because wtf4 poison transcript expression is controlled by Mei4 , and this dependence on a critical meiotic transcription factor may complicate evolutionary suppression of wtf drivers.

How might the genomic context and chromosomal position affect wtf18 drive efficiency?

The genomic context may significantly impact wtf18 function through:

  • Local chromatin environment affecting transcription timing

  • Recombination frequency near the wtf18 locus

  • Linkage to essential genes or other selfish elements

  • Proximity to centromeres or other features affecting segregation

Research approaches should include:

  • Moving wtf18 to different genomic locations and measuring drive efficiency

  • Analyzing chromatin modifications at the wtf18 locus during meiosis

  • Assessing recombination rates near wtf18 in different genetic backgrounds

  • Comparing drive efficiency in different S. pombe isolates with varying genomic arrangements

  • Testing interactions between wtf18 and nearby genetic elements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.