Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf20 (wtf20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To ensure a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
wtf20; wtf6; SPCC1906.04; Meiotic drive suppressor wtf20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
wtf20
Target Protein Sequence
MKNNYTSLKSPLDEEDELKTDHEIDLEKGLLPEYNSEEEGALPPYSDISKLANPVPEDSS TGPTEIANPNVERRQEFKDSHPNIYFLLRLLISVLAVSVVFFTAWVCVNPLEKSIFGKVA FSVTIGITCPILFIAIFYFYETWTKACGKGIKHFLKKWRNMFFTFCKSPIFCLVLLKAEN KLSSHLGDQQWGWKCSASAFTFMAVSSILIFIAETVEPGSCSTDLVKRVQAYCDYEARQY ASSNTAIPLREMNPENEA
Uniprot No.

Target Background

Function
This protein functions as a suppressor component within the dual wtf meiotic drive system. It can suppress, but not confer, meiotic drive by compatible poisons. Wtf meiotic drive systems promote unequal allelic transmission from the parental zygote to progeny spores. This occurs through the encoding of a poison and an antidote from the same locus. The poison acts in trans, forming toxic aggregates in all ascus spores. The antidote, specific to each spore, targets these aggregates for vacuolar degradation. Consequently, meiotic drive by wtf systems results in the poisoning of all progeny that do not inherit the dual poison/antidote allele, or express a compatible antidote.
Database Links
Protein Families
WTF family
Subcellular Location
Spore membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the wtf20 protein and how does it relate to meiotic drive in S. pombe?

The wtf20 (also known as wtf6 or SPCC1906.04) is a member of the wtf gene family found in the fission yeast Schizosaccharomyces pombe. While specifically categorized as "uncharacterized," it belongs to a fascinating family of meiotic drivers that significantly impact inheritance patterns in this organism.

The wtf gene family in S. pombe functions through a poison-antidote system, where:

  • wtf genes encode both poison proteins that kill developing spores and antidote proteins that rescue them

  • The poison and antidote are produced from the same gene using alternative transcriptional start sites

  • This mechanism ensures that spores not inheriting the wtf gene are selectively eliminated

Based on characterization of other wtf family members, wtf20 may potentially function either as a meiotic driver or as a suppressor of drive. Different natural isolates of S. pombe contain between 4-14 predicted killer meiotic drivers from the wtf gene family, with some functioning as drivers and others as suppressors .

While wtf20's specific functional classification is not definitively established in the provided research, its study contributes to our understanding of selfish genetic elements that bias inheritance patterns.

What experimental approaches have been successful in characterizing wtf family proteins?

Based on studies of characterized wtf proteins, several robust methodological approaches can be applied to investigate wtf20:

Fluorescent Protein Tagging for Localization Studies

  • GFP and mCherry fusion constructs have been successfully used to track wtf protein localization

  • Example: "Representative images of Sk Wtf7-GFP localization in spores generated by diploids heterozygous for both Sk wtf7-GFP (green) and nsp1-mCherry (magenta; nucleoporin marker)"

  • This approach reveals subcellular distribution during meiosis and spore formation

Promoter Analysis for Expression Studies

  • Defined promoter regions (e.g., 285 bp upstream sequence) can be isolated to study transcriptional regulation

  • The wtf genes utilize dual transcriptional regulation with distinct promoters for poison and antidote proteins

  • Transcription factor identification: "Mei4 transcription factor, a master regulator of meiosis, controls the expression of the wtf4 poison transcript"

Genetic Manipulation for Functional Analysis

  • Creation of heterozygous diploids (wtf+/wtf-) to assess drive efficiency

  • Mutation studies to uncouple poison and antidote functions

  • Strain background variation tests to determine context-dependence

Systems for Recombinant Expression

  • E. coli expression systems with N-terminal His tags have been effective

  • Purification protocols yield protein suitable for biochemical and structural studies

These approaches provide a methodological framework for investigating wtf20's potential function in meiotic drive mechanisms.

What are the key considerations for designing experiments to study wtf20's potential function in meiotic drive?

When designing experiments to investigate wtf20's potential role in meiotic drive, several critical factors should be considered:

Transcriptional Regulation Analysis

  • Examine both potential promoters - poison and antidote promoters require separate analysis

  • Determine if wtf20 utilizes the dual transcriptional regulation seen in characterized wtf drivers

  • Investigate transcription factor dependencies: "Mei4 transcription factor, a master regulator of meiosis, controls the expression of the wtf4 poison transcript"

Protein Localization Studies

  • Develop GFP/mCherry fusion constructs to track wtf20 localization during meiosis

  • Pay particular attention to selective protein exclusion from developing spores, which is critical for drive mechanisms

  • Compare localization patterns with known drivers and suppressors

Heterozygosity Tests

  • Create heterozygous diploids (wtf20+/wtf20-) to assess potential drive activity

  • Measure spore viability and inheritance patterns to detect segregation distortion

  • Test in multiple strain backgrounds to determine context-dependence

Domain Functionality Analysis

  • Generate truncation or mutation constructs to identify functional domains

  • Separate poison and antidote activities if present

  • Use complementation tests with known wtf drivers to assess functional conservation

Evolutionary Analysis

  • Compare wtf20 sequences across different S. pombe isolates to assess conservation

  • Analyze selection patterns to identify functionally important regions

  • Investigate potential horizontal transfer or gene conversion events within the family

The complex nature of wtf gene regulation suggests experiments must account for both transcriptional timing and protein localization to fully characterize function .

How can recombinant wtf20 protein be optimally stored and handled for experimental use?

Proper storage and handling of recombinant wtf20 protein are critical for maintaining its stability and functional integrity. Based on established protocols, the following guidelines are recommended:

Storage Recommendations

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • For reconstituted protein, store at -20°C for routine use or -80°C for long-term storage

  • Prepare working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

Reconstitution Protocol

  • Briefly centrifuge lyophilized product before opening to collect material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for stability (50% is recommended for optimal preservation)

Buffer Composition

  • Optimal storage buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

  • For working solutions, Tris-based buffer with 50% glycerol is recommended

Stability Considerations

  • Avoid repeated freeze-thaw cycles, which can lead to protein denaturation and aggregation

  • If the protein contains transmembrane domains (likely based on sequence analysis), consider addition of mild detergents to maintain solubility

  • Monitor protein integrity via SDS-PAGE before critical experiments

Following these guidelines will help ensure consistent experimental results when working with recombinant wtf20 protein.

What approaches can be used to identify potential interacting partners of wtf20?

Identifying protein interaction partners is crucial for understanding wtf20's biological function. Several complementary approaches can be employed:

Immunoprecipitation-Based Methods

  • Use anti-wtf20 antibodies (available as polyclonal antibodies per search result ) for co-immunoprecipitation

  • Employ His-tag pull-down assays with recombinant wtf20 as bait

  • Analyze complexes by mass spectrometry to identify interacting proteins

Yeast Two-Hybrid Screening

  • Construct wtf20 baits for screening against S. pombe cDNA libraries

  • Consider membrane yeast two-hybrid systems if transmembrane domains are present

  • Validate interactions with co-immunoprecipitation and co-localization studies

Proximity Labeling Methods

  • Develop BioID or APEX2 fusion constructs with wtf20

  • Express in S. pombe during meiosis to identify proximal proteins

  • Analyze biotinylated proteins by mass spectrometry

Fluorescence-Based Interaction Analyses

  • Create fluorescent protein fusions for Förster resonance energy transfer (FRET) analysis

  • Perform bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

  • Correlate with localization patterns during meiosis and sporulation

Bioinformatic Predictions

  • Use sequence-based interaction predictions to identify candidates

  • Focus on proteins involved in meiosis and chromosome segregation

  • Look for interactions with other wtf family members, as cross-talk between drivers and suppressors may occur

When interpreting results, consider that wtf20 may interact with different partners depending on cellular context and meiotic stage, particularly if it functions similarly to characterized wtf drivers .

How does the expression of wtf genes during meiosis relate to their function as meiotic drivers?

The temporal and spatial expression patterns of wtf genes are critical determinants of their function as meiotic drivers. Research on characterized wtf genes provides valuable insights that may apply to wtf20:

Transcriptional Timing

  • wtf drivers utilize dual transcriptional regulation with distinct promoters for poison and antidote proteins

  • "Transcriptional timing and selective protein exclusion from developing spores ensure that all spores are exposed to Wtf4 poison"

  • The Mei4 transcription factor, a master regulator of meiosis, controls poison transcript expression

Expression Profile During Meiosis

The following pattern has been observed for characterized wtf drivers:

  • Early expression of poison transcripts during meiotic divisions

  • Later expression of antidote transcripts during spore formation

  • Differential stability of poison and antidote proteins

Spatial Distribution

  • "The poison protein assembles into toxic protein aggregates that are packaged into all developing spores"

  • "The antidote protein co-assembles with the poison only in the spores that inherit the wtf gene"

  • Selective exclusion mechanisms ensure differential distribution

Functional Consequences

  • All spores are exposed to poison proteins

  • Only spores inheriting the wtf gene receive sufficient antidote

  • This results in selective killing of spores lacking the wtf gene

  • The observed outcome is transmission rates >90% for the wtf gene from heterozygotes

What are the technical challenges in studying membrane-associated proteins like wtf20?

Based on sequence analysis, wtf20 likely contains transmembrane domains, presenting specific challenges for experimental investigation:

Expression and Purification Challenges

  • Hydrophobic regions often lead to protein aggregation during recombinant expression

  • Lower expression yields compared to soluble proteins

  • Requirement for detergents or lipid environments to maintain native conformation

  • Need for specialized purification protocols to preserve structure and function

Structural Analysis Limitations

  • Difficulties in obtaining crystal structures due to conformational flexibility

  • Challenges in producing sufficient quantities for NMR studies

  • Need for membrane mimetics for accurate structural determination

  • Limited solubility in buffers required for many biophysical techniques

Functional Assay Considerations

  • Proper folding dependent on membrane environment

  • Activity may require specific lipid compositions

  • Interactions may be transient or dependent on membrane microdomains

  • Function may be affected by protein orientation in the membrane

Localization Study Adaptations

  • Fluorescent protein tags may interfere with membrane insertion

  • Need to verify that tags don't disrupt localization or function

  • Requirement for membrane-specific markers for co-localization studies

Overcoming These Challenges

  • Use mild detergents (e.g., DDM, CHAPS) during purification

  • Consider nanodiscs or liposomes for functional studies

  • Employ split-GFP approaches for localization studies

  • Utilize cryo-electron microscopy for structural determination

Addressing these challenges requires specialized approaches but is essential for understanding wtf20's potential role in meiotic drive mechanisms.

How do wtf genes contribute to reproductive isolation in S. pombe and what evolutionary implications does this have?

The wtf gene family plays a significant role in reproductive isolation between S. pombe strains, with important evolutionary implications:

Mechanism of Reproductive Isolation

  • Heterozygous S. pombe diploids from crossing distinct isolates produce very few viable spores

  • "Largely because of these drivers, heterozygous S. pombe diploids generated by crossing distinct isolates generally produce very few viable spores"

  • Different strains contain different complements of wtf drivers and suppressors

  • When strains with different wtf genes hybridize, unsuppressed drivers reduce hybrid fertility

Evolutionary Dynamics

  • The wtf gene family shows rapid diversification between isolates

  • "The numbers and sequences of wtf genes vary considerably between S. pombe isolates, indicating rapid divergence"

  • Natural isolates contain between 4-14 predicted killer meiotic drivers from the wtf gene family

  • This variation suggests ongoing evolutionary conflict

Selective Pressures

  • Despite fitness costs, wtf drivers persist in populations

  • "The wtf genes confer no known fitness benefits, yet are present in multiple copies in all sequenced isolates of S. pombe"

  • This persistence demonstrates the success of their selfish transmission strategy

  • Driving selection for suppressors and resistance mechanisms

Broader Implications

  • The wtf system represents an ideal model for understanding how segregation-distorting elements evolve

  • These elements may contribute to speciation through reproductive isolation

  • The poison-antidote mechanism exemplifies genetic conflict at the molecular level

  • Understanding wtf evolution provides insights into selfish genetic element dynamics in general

Research suggests wtf20, as part of this diverse gene family, may contribute to these evolutionary processes, though its specific role remains to be characterized .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.