Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf6 (wtf6)

Shipped with Ice Packs
In Stock

Description

Introduction

Schizosaccharomyces pombe, commonly known as fission yeast, is a popular model organism in genetics and molecular biology . Its genome encodes numerous proteins with unknown functions. Among these is a protein designated as "Uncharacterized protein Wtf6," also known as Wtf6 . Wtf6 is part of a family of proteins involved in meiotic drive, a phenomenon where certain genes are preferentially inherited during sexual reproduction . These Wtf proteins include a poison and an antidote that together result in the targeted killing of spores that do not inherit the Wtf driver .

Basic Information

FeatureDescription
OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Synonymswtf6
ORF NameSPCC1906.04
Protein TypeTransmembrane Protein
UniProt Accession No.G2TRU9
Molecular WeightNot specified in the provided texts, but can be found in related databases such as UniProt
Amino Acid SequenceMKFDLEKGPLPEYDSEEESTLPPYSDHARLSNSPNTHRENNPSRSTDNSSPLLIKLLISFTSIILFNAPAVCYLKYKDAFFKNYGAAEWTLFGFWCLVCTLALIFLTYFYETWTKAVKVTVISLAKCVKVTAIFLAQCVKACGKGIKHFLKKWENMPMAFSEVFLFNILVRSPRMNLRYIFGDRWGLKCSLADHIIFVVFEHPCFYC
Expression Region1-207

Function and Significance

Role in Protein Secretion

Research indicates that high-level protein secretion can cause significant changes in protein expression levels within the cell . Comparative proteome analysis has proven to be a valuable method for identifying targets to improve protein production and secretion in S. pombe . Studies have used model proteins like maltase to investigate the proteomic response of S. pombe cells to increased levels of protein secretion .

Involvement in Proteasome Regulation

The 26S proteasome in S. pombe is a critical complex responsible for degrading polyubiquitinated proteins . Proper assembly of the 26S proteasome is essential for its function. Wtf6 interacts with other proteins involved in proteasome regulation . For example, Yin6, the S. pombe ortholog of mammalian Int6, regulates the 26S proteasome by binding to the proteasome lid subunit Rpn5 .

Mating Phenotypes and Meiotic Drive

Natural variations in mating phenotypes in S. pombe can significantly impact the spread of wtf meiotic drivers . S. pombe isolates collected from the wild exhibit different inbreeding coefficients, affecting the formation of heterozygotes . The wtf driver has the greatest advantage when the inbreeding coefficient is -1, as all matings generate heterozygotes .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
wtf6; SPCC553.05c; Uncharacterized protein wtf6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
wtf6
Target Protein Sequence
MKFDLEKGPLPEYDSEEESTLPPYSDHARLSNSPNTHRENNPSRSTDNSSPLLIKLLISF TSIILFNAPAVCYLKYKDAFFKNYGAAEWTLFGFWCLVCTLALIFLTYFYETWTKAVKVT VISLAKCVKVTAIFLAQCVKACGKGIKHFLKKWENMPMAFSEVFLFNILVRSPRMNLRYI FGDRWGLKCSLADHIIFVVFEHPCFYC
Uniprot No.

Q&A

What is the wtf6 protein in Schizosaccharomyces pombe?

Wtf6 is part of the wtf (with Tf) gene family in S. pombe, functioning as a meiotic drive element. Similar to other characterized wtf proteins like wtf20, it likely plays a role in meiotic drive mechanisms. The protein contains transmembrane domains and is expressed during meiosis. The wtf gene family has evolved rapidly and contributes to reproductive isolation between different S. pombe strains through meiotic drive suppression mechanisms .

How should recombinant wtf6 protein be stored and reconstituted?

For optimal stability and activity:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Avoid repeated freeze-thaw cycles by preparing working aliquots

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 20-50% for long-term storage

  • Store working aliquots at 4°C for no longer than one week

What expression systems are commonly used for recombinant wtf6 protein production?

E. coli expression systems are typically used for recombinant wtf protein production, with His-tagging being a common purification approach. For wtf proteins:

Expression SystemTagAdvantagesChallenges
E. coliHisHigh yield, easy purificationPotential misfolding of transmembrane domains
Yeast (S. cerevisiae)GST or HisBetter folding of eukaryotic proteinsLower yield than E. coli
S. pombeNative or HisNative modifications, proper foldingMore complex cultivation requirements

E. coli remains the most widely used system due to its simplicity and high yield potential, despite possible limitations in proper folding of transmembrane regions .

How do experimental conditions affect wtf6 protein activity in recombination assays?

When designing recombination assays with wtf6:

  • pH dependency: Meiotic drive elements typically show optimal activity at pH 6.5-7.5, reflecting the nuclear environment during meiosis.

  • Temperature sensitivity: Activity assays should be conducted at 30°C (S. pombe optimal growth temperature) to mimic physiological conditions.

  • Salt concentration effects: Buffer composition significantly impacts wtf protein activity:

Salt ConcentrationEffect on wtf ActivityRecommended Use Case
Low (50-100mM NaCl)Enhanced DNA bindingDNA interaction studies
Moderate (150-200mM NaCl)Balanced activityGeneral assays
High (>250mM NaCl)Reduced aggregationStability studies
  • Reducing agents: Include 1-5mM DTT or β-mercaptoethanol to maintain cysteine residues in reduced state for proper folding and function .

What approaches can resolve contradictory data when studying wtf6 meiotic drive mechanisms?

When facing contradictory results in wtf6 research:

  • Systematically evaluate experimental variables:

    • Strain background effects (genetic modifiers may exist)

    • Expression levels (overexpression can cause artifacts)

    • Assay conditions (temperature, media composition)

  • Employ orthogonal techniques:

    • Combine genetic approaches with biochemical validation

    • Use both in vivo and in vitro systems to cross-validate findings

    • Apply both microscopy and molecular biology approaches

  • Revisit underlying assumptions:

    • Challenge the established model of wtf protein function

    • Consider potential moonlighting functions beyond meiotic drive

  • Refine variables and implement additional controls:

    • Include closely related wtf proteins (wtf20) as comparative controls

    • Test dose-dependent effects to identify threshold phenomena

How can evolution experiments be designed to study wtf6 functional adaptation?

Designing evolution experiments with wtf6 requires considering four technical phases:

  • Generating initial variation through crossing:

    • Cross S. pombe strains with different wtf6 alleles

    • Employ directed mutagenesis to create variant libraries

    • Use CRISPR-Cas9 to introduce specific mutations

  • Recovering recombinant individuals harboring variation:

    • Select using appropriate markers flanking the wtf6 locus

    • Screen for meiotic drive phenotypes

    • Sequence to confirm genotypes

  • Imposing selection:

    • Apply competitive sporulation conditions

    • Use nutrient limitation to enhance meiotic frequency

    • Create environmental stressors to accelerate adaptive processes

  • Maintaining variation through additional outcrossing:

    • Implement periodic crossing to wild-type strains

    • Create heterozygous populations to observe drive dynamics

    • Monitor allele frequencies through multiple generations

What assays can quantify wtf6-mediated chromosomal recombination events?

Several assays can be employed to study wtf6-mediated recombination:

  • Non-tandem repeat assays:

    • Measure recombination at repetitive elements using selectable markers

    • Detect deletions, inversions, or duplications

    • Compare recombination hotspot activity

  • Mitotic recombination assays:

    • Quantify DNA double-strand break repair efficiency

    • Measure homologous recombination frequencies

    • Analyze recombination outcomes (crossovers vs. non-crossovers)

  • Meiotic drive assays:

    • Tetrad analysis to detect non-Mendelian segregation

    • Spore viability assessment

    • Competitive sporulation experiments

  • Chromosomal rearrangement detection:

    • Pulsed-field gel electrophoresis to detect large-scale changes

    • Comparative genomic hybridization

    • Whole-genome sequencing to identify structural variations

How should research questions about wtf6 function be formulated?

Formulating effective research questions for wtf6 studies requires:

  • Clarity and concision: "How does wtf6 sequence variation correlate with meiotic drive strength in different S. pombe isolates?"

  • Specific scope: "What role do the transmembrane domains of wtf6 play in protein localization during meiosis I versus meiosis II?"

  • Feasibility: Ensure questions can be answered with available techniques and within reasonable timeframes

  • Build on existing knowledge: "How does wtf6 interact with the previously characterized wtf4 protein during meiotic drive events?"

Compare these well-formulated questions with problematic examples:

Problematic QuestionImproved QuestionImprovement Reason
"Does wtf6 affect meiosis?""How does wtf6 expression timing influence chromosome segregation during meiosis I?"More specific, not answerable with yes/no
"What are all the effects of wtf6 on S. pombe?""What cellular pathways are differentially regulated in wtf6 knockout versus wild-type S. pombe during nitrogen starvation?"Narrowed scope, more testable
"Is wtf6 the most important meiotic drive element?""How does the drive efficiency of wtf6 compare to wtf4 and wtf20 under standard laboratory meiosis conditions?"Removed subjective judgment, made comparative

Good research questions should open new avenues of investigation while remaining grounded in testable hypotheses .

What controls are essential when studying recombinant wtf6 protein activity?

Essential controls for wtf6 functional studies include:

  • Vector-only control: Cells expressing empty vector to account for expression system effects

  • Inactive mutant control: wtf6 with site-directed mutations in predicted functional domains

  • Related protein control: Other wtf family members (wtf20) to distinguish family-wide vs. specific effects

  • Wild-type vs. tagged protein comparison: Verify tag doesn't interfere with function

  • Cellular compartment controls:

    • Cytoplasmic marker (e.g., GFP)

    • Nuclear marker (e.g., histone-mCherry)

    • Membrane marker (e.g., Pma1-mTagBFP)

    These help validate localization patterns and potential interactions

How should contradictory results in wtf6 research be addressed?

When facing unexpected or contradictory data:

  • Examine the data thoroughly:

    • Check for experimental artifacts or contamination

    • Analyze outliers to determine if they represent meaningful biological variation

    • Verify reagent quality and experimental conditions

  • Re-evaluate initial assumptions:

    • Consider whether the original hypothesis was based on incomplete information

    • Examine if wtf6 has context-dependent functions

    • Investigate whether strain-specific genetic backgrounds influence results

  • Consider alternative explanations:

    • Explore moonlighting functions of wtf6 beyond meiotic drive

    • Investigate potential indirect effects through other cellular pathways

    • Examine interactions with other wtf family members

  • Modify experimental approach:

    • Employ orthogonal techniques to validate findings

    • Adjust experimental conditions systematically

    • Develop more sensitive or specific assays if needed

What bioinformatic approaches can predict wtf6 protein structure and function?

Modern bioinformatic approaches for wtf6 structure-function analysis include:

  • Homology modeling:

    • Use solved structures of related proteins as templates

    • Apply threading approaches for regions with low sequence conservation

    • Validate models through molecular dynamics simulations

  • Machine learning prediction:

    • Employ neural network-based structure prediction (AlphaFold2)

    • Use feature-based function prediction algorithms

    • Implement conservation analysis across wtf family members

  • Evolutionary analysis:

    • Conduct selection pressure analysis (dN/dS ratios)

    • Identify conserved domains across fungal species

    • Perform phylogenetic profiling to infer functional relationships

  • Integrative approaches:

    • Combine experimental data with computational predictions

    • Implement network analysis to identify functional partners

    • Use protein-protein interaction prediction algorithms

How can wtf6 research inform our understanding of meiotic drive systems across species?

The study of wtf6 contributes to broader understanding of meiotic drive through:

  • Comparative genomics: Identifying similar systems in other fungi and potentially higher eukaryotes

  • Evolutionary mechanisms: Understanding how selfish genetic elements shape genome architecture

  • Reproductive isolation: Clarifying mechanisms behind speciation events

  • Genetic conflict resolution: Revealing how organisms evolve suppressors to counteract drive elements

Future research directions could include:

Research AreaQuestionPotential Impact
Structural biologyWhat structural features enable wtf6 drive activity?Design of synthetic drive systems
Evolutionary genomicsHow have wtf elements coevolved with their suppressors?Understanding of genetic conflict resolution
Synthetic biologyCan wtf6 elements be engineered as genetic tools?Development of new chromosome manipulation technologies
Comparative biologyDo similar mechanisms exist in multicellular organisms?Broader understanding of genetic conflict across taxa

These investigations will continue to expand our understanding of fundamental genetic processes and potentially lead to biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.