Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf7 (wtf7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. Please specify your required tag type for preferential development.

Synonyms
wtf7; SPCC736.05; Wtf element wtf7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
wtf7
Target Protein Sequence
MSGSYAPIEDSADELSVHSGNDNEIDLEKGLLPKCNTGNGGTTPCSEPPHYDSDAVVEMD MYENNIYMRTFKLRPFAKSGVTNSSNVVFQMKTYENNRHMQTFRLRPFAKNGVTNGVKLA QSLFLLLPFNFIFFACLFFRKASFTDFSLMGWILFGIWCLTCFLSSFILYAYHESWTKFA RERSQEFSLILFGLLFPGIVTMVVFYALYMRSMYG
Uniprot No.

Target Background

Function

May act in meiotic drive.

Database Links
Protein Families
WTF family
Subcellular Location
Spore membrane; Multi-pass membrane protein.

Q&A

What is Wtf7 and how does it relate to other proteins in the Wtf family?

Wtf7 is an uncharacterized protein encoded by the wtf7 gene in Schizosaccharomyces pombe. It belongs to the wtf (with Tf) gene family, which functions as meiotic drivers. The wtf genes encode both poison and antidote proteins that together execute targeted killing of spores that do not inherit the wtf driver. Wtf7 is one of many wtf genes found across S. pombe strains, with different isolates containing between 4-14 drivers and 8-17 suppressors of drive . The protein consists of 215 amino acids and contains transmembrane domains that are characteristic of the Wtf family .

What mechanisms control the expression of Wtf7 poison and antidote proteins?

The expression of Wtf proteins, including Wtf7, is controlled through dual transcriptional regulation. For the characterized members of the family, alternative transcriptional start sites produce two distinct transcripts: a longer transcript encoding the antidote protein and a shorter transcript encoding the poison protein. The Mei4 transcription factor, a master regulator of meiosis in S. pombe, controls the expression of the poison transcript, as demonstrated with Wtf4 . This regulatory mechanism likely applies to Wtf7 as well, though specific studies confirming this for Wtf7 are not explicitly mentioned in the available data. The timing of poison and antidote expression is critical to the function of these drivers, ensuring that all spores are exposed to the poison while only those inheriting the wtf gene receive sufficient antidote .

How does the localization of Wtf7 contribute to its function?

While specific localization studies for Wtf7 are not detailed in the search results, inferences can be made based on other characterized Wtf proteins. For example, with Wtf4, transcriptional timing and selective protein exclusion from developing spores ensure that all spores are exposed to the poison, but only spores inheriting the wtf4 gene receive adequate antidote for survival . The Wtf proteins contain transmembrane domains that likely facilitate their association with cellular membranes. In the case of Wtf4, the poison protein assembles into toxic aggregates packaged into all developing spores, while the antidote co-assembles with the poison in spores that inherit the gene, neutralizing it by promoting trafficking to the vacuole . Similar mechanisms likely apply to Wtf7, though direct experimental confirmation is needed.

How do mating behaviors in S. pombe influence the spread of wtf drivers like wtf7?

Mating phenotypes in S. pombe are diverse and can significantly impact the spread of wtf meiotic drivers. Different natural isolates of S. pombe show varying inbreeding coefficients, ranging from preferential inbreeding similar to the reference strain to more random mating patterns . These mating behaviors directly affect the frequency of heterozygotes in the population and consequently the effectiveness of meiotic drive. Population genetic models demonstrate that inbreeding coefficients near 0.5 slow but do not stop the spread of drivers. The fitness of driver heterozygotes is reduced to approximately 0.51 (compared to homozygotes) due to the killing of spores that don't inherit the driver .

What evolutionary pressures might maintain wtf drivers despite their fitness costs?

The persistence of wtf drivers despite their significant fitness costs to heterozygotes presents an evolutionary puzzle. Several factors likely contribute to their maintenance:

  • Strong transmission advantage (>90%) from heterozygotes

  • Ability to spread even in populations with significant inbreeding

  • Potential benefits from linkage to beneficial alleles

  • Complex interactions between multiple drivers and suppressors

  • Adaptation to the fitness costs through mechanisms that produce aneuploid spores

Research suggests that the fitness costs of drive are partially mitigated in S. pombe by the tolerance of aneuploidy for chromosome 3, where most wtf genes are located . Additionally, the complex evolutionary dynamics between multiple drivers and suppressors may create situations where no single equilibrium is reached, allowing for the continued maintenance of these selfish genetic elements .

What expression systems are recommended for producing recombinant Wtf7 protein?

The available commercial recombinant Wtf7 proteins are expressed using several different systems:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, widely accessibleMay lack post-translational modifications
Cell-free expressionRapid production, avoids toxicity issuesMay have lower yields
Yeast systemsNative post-translational modificationsMore complex than bacterial systems
Mammalian cellsComplex folding and modificationsMost expensive, lower yields

The choice depends on the research goals. For structural studies or antibody production, E. coli-expressed protein (as described in search result ) may be sufficient. For functional studies, expression in S. pombe itself might be preferable to maintain native folding and modifications. The recombinant Wtf7 protein with His-tag described in search result was expressed in E. coli and covers the full-length protein (amino acids 1-215) .

What methods are effective for studying the localization and interactions of Wtf7 during meiosis?

For studying Wtf7 localization and interactions during meiosis, researchers can adapt approaches used for other Wtf proteins:

  • Fluorescent fusion proteins: Creating Wtf7-GFP/mCherry fusion proteins to visualize localization in live cells during meiosis

  • Immunofluorescence: Using specific antibodies against Wtf7 for fixed-cell imaging

  • Co-immunoprecipitation: Identifying interaction partners by pulling down Wtf7 complexes

  • Yeast two-hybrid screening: Detecting binary interactions with candidate proteins

  • Proximity labeling: Using BioID or APEX2 fusions to identify proteins in the vicinity of Wtf7

For example, studies with Rec7-GFP fusion proteins (another meiosis-specific protein in S. pombe) demonstrated localization in the nucleus before karyogamy, during prophase, and after meiosis I, with approximately 50 foci observed in prophase nuclei . Similar approaches could be applied to Wtf7, with careful consideration of which terminus to tag to avoid disrupting functional domains.

How can researchers generate and validate wtf7 mutations or deletions?

To generate and validate wtf7 mutations or deletions, researchers can employ several strategies:

  • CRISPR-Cas9 genome editing: Design guide RNAs targeting wtf7 and introduce specific mutations or deletions

  • Homologous recombination: Replace wtf7 with a selectable marker (e.g., antibiotic resistance)

  • Insertion of marker genes: Following the approach in search result , introducing markers like hphMX6 or kanMX4 through targeted integration

Validation methods should include:

  • PCR verification of deletion/mutation

  • Sequencing to confirm exact modifications

  • Expression analysis via RT-PCR or RNA-seq

  • Phenotypic analysis of meiotic outcomes (spore viability, drive effects)

  • Complementation tests with wild-type wtf7 to confirm phenotype causality

The challenge with wtf genes is their repetitive nature and high sequence similarity, which may complicate specific targeting. Careful primer design and validation are essential to ensure specificity .

How should researchers analyze sequencing data to accurately identify and annotate wtf7 genes?

Accurate identification and annotation of wtf7 genes present significant challenges due to their repetitive nature, sequence similarity to other wtf genes, and potential pseudogenes. Based on search result , researchers should employ a multi-step approach:

  • Initial identification:

    • Use PSI-BLAST searches with known wtf proteins as queries

    • Employ BLASTn searches with nucleotide sequences to find potential pseudogenes

    • Consider hits more than 200 base pairs long (shorter hits may still be homologous)

  • Refinement of predictions:

    • Use sequence alignments of candidate wtf genes within and between species

    • Generate long-read RNA sequencing data (e.g., Oxford Nanopore) to facilitate delineation of exon-intron boundaries

    • Compare with known wtf gene structures to identify features like alternative transcriptional start sites

  • Validation:

    • Confirm transcription through RT-PCR or RNA-seq

    • Validate protein expression if antibodies are available

    • Functionally test for drive activity

Researchers should be aware of the significant annotation errors found in publicly available genomic data, as highlighted in search result . These errors can propagate rapidly as scientists build on previous annotations when sequencing new genomes, potentially leading to misidentification of genes like wtf7 .

What control experiments are essential when studying the functional effects of Wtf7?

When studying the functional effects of Wtf7, several critical control experiments should be included:

  • Genetic controls:

    • Complete gene deletion to establish null phenotype

    • Point mutations in key domains to distinguish functional regions

    • Complementation with wild-type gene to confirm phenotype attribution

  • Expression controls:

    • Quantification of both poison and antidote transcript levels via qRT-PCR

    • Protein expression verification through western blotting

    • Temporal analysis of expression throughout meiosis

  • Functional controls:

    • Comparison with characterized wtf family members (e.g., wtf4)

    • Analysis in both heterozygous and homozygous conditions

    • Tests in different genetic backgrounds to account for strain-specific effects

  • Specificity controls:

    • Tests with related wtf genes to determine specificity of observed effects

    • Cross-species complementation to assess functional conservation

    • Domain swapping between wtf family members to identify functional regions

Given that wtf drivers often compete with each other and their effects can vary in heterozygous versus homozygous contexts, experiments should be designed to account for these complexities .

How might the dual transcriptional regulation of wtf genes influence efforts to develop universal suppressors of wtf drivers?

The dual transcriptional regulation of wtf genes, particularly the involvement of the Mei4 transcription factor in controlling the poison transcript, presents significant challenges for developing universal suppressors of wtf drivers. As noted in search result , "this transcriptional regulation, which includes the use of a critical meiotic transcription factor, likely complicates the universal suppression of wtf."

Potential approaches and challenges for developing suppressors include:

  • Targeting shared regulatory elements:

    • Advantage: Could affect multiple wtf genes simultaneously

    • Challenge: May disrupt essential meiotic processes since Mei4 is a master regulator of meiosis

  • Modifying antidote expression:

    • Approach: Developing synthetic antidotes with constitutive expression

    • Challenge: Would need to address the diversity of poison proteins across the wtf family

  • Epigenetic regulation:

    • Approach: Targeted silencing of wtf loci through chromatin modifications

    • Challenge: Specificity issues given the repetitive nature of wtf genes

  • Evolutionary considerations:

    • The arms race between drivers and suppressors has likely already produced natural suppression mechanisms

    • Understanding how the 8-17 natural suppressors of drive function could inform synthetic approaches

The resolution of this challenge requires a deeper understanding of the specific transcriptional regulation of wtf7 and other family members, as well as the functional domains of both poison and antidote proteins.

What role might Wtf7 play in the evolutionary arms race between drivers and suppressors in natural S. pombe populations?

  • As a driver: Wtf7 may function as one of the 4-14 drivers found in natural isolates, contributing to the complex network of competing selfish genetic elements .

  • In diversification: The limited conservation of Wtf proteins across species, with highest conservation in the N-terminal antidote-specific sequences, suggests ongoing diversification possibly driven by competition between wtf family members .

  • Interaction with mating systems: The effectiveness of Wtf7 as a driver would be influenced by the mating behaviors of different S. pombe isolates, which show varying inbreeding coefficients .

  • Chromosomal location: Like most wtf genes, Wtf7 is likely located on chromosome 3, the only chromosome in S. pombe that tolerates aneuploidy. This positioning may represent an adaptation that mitigates the fitness costs of drive through the production of disomic spores .

To fully understand Wtf7's specific role, comparative studies across multiple S. pombe isolates would be necessary, examining both the sequence diversity of Wtf7 and its functional impact in various genetic backgrounds.

How might methodological advances in protein characterization help resolve contradictions in the current understanding of Wtf7 function?

Advanced protein characterization methods could help resolve several key questions and potential contradictions regarding Wtf7 function:

  • Structural biology approaches:

    • Cryo-electron microscopy of Wtf7 complexes could reveal how poison and antidote proteins interact

    • X-ray crystallography of the conserved N-terminal domain might explain the specificity of antidote function

    • Solution NMR to examine dynamics of membrane interactions

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize Wtf7 localization at nanoscale resolution

    • Single-molecule tracking to follow Wtf7 dynamics during meiosis

    • Correlative light and electron microscopy to connect protein localization with ultrastructural features

  • Proteomic approaches:

    • Proximity labeling to identify interaction partners in vivo

    • Cross-linking mass spectrometry to map interaction interfaces

    • Thermal proteome profiling to detect conformational changes upon binding

  • Functional genomics:

    • CRISPR screening to identify genes affecting Wtf7 function

    • Synthetic genetic array analysis to map genetic interactions

    • Pooled fitness assays to quantify competitive advantages/disadvantages

These advanced methods could help resolve contradictions by providing direct evidence of Wtf7's molecular mechanism, distinguishing between models of protein function, and precisely defining the temporal and spatial dynamics of Wtf7 activity during meiosis.

What strategies can help overcome the challenges in expressing and purifying functionally active Wtf7?

Expressing and purifying functionally active Wtf7 presents several challenges, particularly given its transmembrane domains and potential toxicity. Based on commercial protein production information and research approaches for similar proteins, the following strategies may be helpful:

ChallengeStrategyRationale
Toxicity to expression hostUse inducible expression systemsMinimizes exposure time to potentially toxic protein
Insolubility due to transmembrane domainsUse detergents or membrane mimeticsProvides hydrophobic environment for proper folding
Low yieldTry fusion partners (MBP, SUMO, Trx)Enhances solubility and expression levels
Protein aggregationExpress at lower temperatures (16-18°C)Slows folding to reduce aggregation
Difficulty purifying full-length proteinConsider expressing functional domains separatelyMay improve yield of structurally intact protein
Inclusion bodiesRefold from denaturantsRecovery of protein from aggregates
Loss of activity during purificationInclude stabilizing agentsPrevents denaturation during purification

Commercial recombinant Wtf7 proteins are available with His-tags and are typically stored in Tris-based buffers with glycerol at -20°C/-80°C . For experimental work requiring functional activity, validating the protein's meiotic drive activity in S. pombe might be necessary through complementation assays with wtf7 deletion strains.

How can researchers address the reproducibility challenges when studying the effects of wtf7 in different S. pombe strains?

Reproducibility challenges when studying wtf7 across different S. pombe strains stem from natural variation in genetic backgrounds, mating behaviors, and the presence of other wtf genes. To address these challenges:

  • Strain characterization:

    • Fully sequence and annotate all wtf genes in experimental strains

    • Determine the mating behavior and inbreeding coefficient of each strain

    • Document the presence of natural suppressors of drive

  • Experimental design:

    • Include multiple reference strains as controls

    • Use isogenic lines differing only in the wtf7 locus

    • Perform experiments in both homozygous and heterozygous contexts

  • Standardized protocols:

    • Develop and share detailed protocols for mating, sporulation, and phenotypic analysis

    • Standardize growth conditions and media composition

    • Use quantitative readouts rather than qualitative assessments

  • Data reporting:

    • Report complete strain genealogy and construction methods

    • Document all genetic modifications in detail

    • Share raw data alongside processed results

  • Collaborative validation:

    • Establish multi-laboratory validation studies

    • Create a repository of standardized strains for wtf research

These approaches can help distinguish strain-specific effects from those genuinely attributable to wtf7 function, improving reproducibility across different research groups.

What emerging technologies might advance our understanding of Wtf7's role in meiotic drive systems?

Several emerging technologies hold promise for advancing our understanding of Wtf7 and other meiotic drive systems:

  • Long-read sequencing technologies:

    • Oxford Nanopore and PacBio sequencing for improved assembly of repetitive wtf regions

    • Direct RNA sequencing to better characterize isoforms without PCR bias

    • These approaches could help address annotation errors highlighted in search result

  • Single-cell approaches:

    • Single-cell RNA-seq to examine expression heterogeneity during meiosis

    • Single-cell proteomics to quantify protein levels in individual developing spores

    • These methods could reveal cell-to-cell variability in Wtf7 expression and activity

  • In situ techniques:

    • Spatial transcriptomics to map gene expression within ascus structures

    • Expansion microscopy for improved visualization of protein localization

    • These could help understand the spatial dynamics of poison and antidote distribution

  • CRISPR technologies:

    • Base editing for precise mutation introduction without double-strand breaks

    • Prime editing for targeted sequence replacements

    • Epigenome editing to manipulate expression without sequence changes

  • Synthetic biology approaches:

    • Engineered meiotic drive systems based on Wtf principles

    • Synthetic genetic circuits to control drive activity

    • These could both test mechanistic hypotheses and develop potential applications

These technologies could help resolve current limitations in understanding Wtf7 function, particularly regarding the precise mechanisms of transcriptional regulation, protein trafficking, and interaction with other cellular components during meiosis.

How might understanding Wtf7 and other meiotic drivers contribute to broader evolutionary theory?

Understanding Wtf7 and related meiotic drivers has several important implications for evolutionary theory:

  • Selfish genetic element dynamics:

    • Wtf systems provide a model for studying how selfish genetic elements persist despite fitness costs

    • The drive/suppressor arms race exemplifies Red Queen dynamics in molecular evolution

    • Research on wtf genes helps explain how genetic conflicts shape genome architecture

  • Speciation mechanisms:

    • Meiotic drivers can contribute to reproductive isolation between populations

    • Differences in wtf repertoires between strains may create partial hybrid incompatibilities

    • These dynamics could inform models of speciation driven by intragenomic conflict

  • Mating system evolution:

    • The relationship between inbreeding and drive efficacy illustrates how mating systems and selfish genetic elements coevolve

    • This provides insights into the evolutionary forces shaping reproductive strategies

  • Genome defense mechanisms:

    • Understanding how organisms suppress or tolerate meiotic drivers informs theories about genome defense

    • The tolerance of aneuploidy for chromosome 3 in S. pombe represents an unusual adaptive response to drive

  • Evolutionary tradeoffs:

    • The fitness costs of harboring wtf drivers illustrate evolutionary compromises

    • The persistence of these systems despite costs demonstrates how transmission advantage can outweigh fitness reduction

These insights from the wtf system could be applied to other genetic conflicts across the tree of life, contributing to a more comprehensive understanding of genome evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.