Recombinant Schizosaccharomyces pombe Uncharacterized RING finger protein C32F12.07c (SPBC32F12.07c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPBC32F12.07c; Uncharacterized RING finger protein C32F12.07c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC32F12.07c
Target Protein Sequence
MTDTAKYEKSSARCWICYEEYDKKLCSLSNDSWRRPCRCSLIAHESCLISYITRSGSTRC PQCLTAYRIAKPPKEKSWAVNVLGIGHSLEAGLAQVTFGVGSCLGITKFIYSIFKQTGIW ICKQVADESSLIEMLKKPVFSSVVLPLLPCMLVRFYEAPPYDIAFSLYTHFSIYSCAEKI SNTSLLLCTLPWVRSLYKELMTRIFDGIVIGADGEFEDSETDWFRQFEAQVEHRNQVEDV NEREDTESEFWILLSVAHVFLDAFTTKILRIVRPILLFPLAGKFLGRFIPGNFTKLEKSI IGAFAALVFKDIFVYGFIAWRKRKPWSIRILDNPRRVSDS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is SPBC32F12.07c and what is its functional classification in S. pombe?

    SPBC32F12.07c is an uncharacterized RING finger protein in Schizosaccharomyces pombe classified as a ubiquitin-protein ligase E3 of the MARCH (Membrane-Associated RING-CH) family . The protein contains a C3HC4 type (RING) zinc finger domain that likely mediates protein-protein interactions .

    The full-length protein consists of 340 amino acids with multiple functional domains, including the characteristic RING finger domain essential for E3 ligase activity. As a putative E3 ubiquitin ligase, SPBC32F12.07c likely participates in the ubiquitin-proteasome system, targeting specific proteins for ubiquitination and subsequent degradation or altered function.

    Sequence analysis reveals it shares homology with other RING finger E3 ubiquitin ligases, suggesting conservation of function across species, though its specific biological role in S. pombe remains to be fully characterized .

  • How is the genome of S. pombe organized and what significance does this have for SPBC32F12.07c research?

    S. pombe has a relatively compact genome distributed across three chromosomes with approximately 5,000 protein-coding genes. The genome displays an uneven pattern of sequence variants with variant-rich regions occupying about half of the nuclear genome (50.3% of the 5-kb windows have more than ten SNPs) .

    The SPBC32F12.07c gene is located on chromosome II and was identified during sequence analysis of a 39,648 bp segment contained in cosmid c32F12 from the right arm of chromosome II . This region contains 15 non-overlapping open reading frames longer than 300 bp. Understanding this genomic context is crucial for:

    • Designing specific primers for PCR amplification

    • Creating targeted genetic modifications

    • Analyzing potential co-regulated genes in the same chromosomal region

    • Interpreting experimental data in relation to neighboring genes

    Researchers should note that S. pombe exhibits a mosaic pattern of variant distribution similar to that observed in S. cerevisiae, potentially resulting from infrequent outcrossing between strains of distinct lineages .

  • What methodologies can be used to study SPBC32F12.07c expression patterns?

    Multiple complementary approaches can be employed:

    Transcriptional Analysis:

    • RT-PCR and qRT-PCR using primers specific to SPBC32F12.07c

    • RNA-Seq to measure expression levels across different conditions

    • Northern blotting for transcript size verification

    • Microarray analysis as used in studies of other S. pombe genes

    Protein Detection:

    • Western blotting using commercial antibodies like the rabbit polyclonal antibody (CSB-PA524249XA01SXV-2)

    • GFP-tagging of SPBC32F12.07c for visualization and quantification

    • Proteomics approaches (mass spectrometry)

    Expression Pattern Analysis:

    • Promoter-reporter fusions (e.g., with GFP or lacZ)

    • ChIP-seq to identify transcription factors regulating SPBC32F12.07c

    • Cell cycle synchronization to detect phase-specific expression patterns

    When analyzing expression data, researchers should consider the baseline transcriptional profiling of wild-type S. pombe during vegetative growth as a reference point .

Advanced Research Questions

  • How can I design experiments to identify and validate the E3 ligase activity of SPBC32F12.07c?

    A comprehensive approach to establish E3 ligase activity includes:

    In vitro Ubiquitination Assays:

    • Purify recombinant SPBC32F12.07c protein (available commercially or self-expressed)

    • Perform in vitro ubiquitination reactions with:

      • Ubiquitin

      • E1 enzyme

      • Compatible E2 enzymes (test multiple E2s: UbcH5, UbcH6, Ubc4, etc.)

      • ATP regeneration system

      • Potential substrates or substrate library

    • Analyze ubiquitination by Western blotting or mass spectrometry

    E3 Ligase Activity Validation:

    • Generate point mutations in the RING domain (particularly the conserved cysteine residues)

    • Compare wild-type and mutant activity in vitro

    • Perform structure-function analysis using domain deletion constructs

    Substrate Identification Strategies:

    • Yeast two-hybrid screens for interacting partners

    • Co-immunoprecipitation coupled with mass spectrometry

    • Comparative proteomics in wild-type vs. SPBC32F12.07c knockout strains

    • BioID or proximity labeling approaches

    For validation, researchers should examine whether SPBC32F12.07c can catalyze the formation of a high molecular weight ubiquitin smear in vitro, similar to what has been observed with other RING E3 ligases like RNF115 .

  • What approaches can be used to generate and validate knockout or knockdown strains for SPBC32F12.07c in S. pombe?

    Generation Methods:

    1. Homologous Recombination:

      • Design constructs with selectable markers flanked by homology regions

      • Transform S. pombe cells and select for integrants

      • Confirm correct integration by PCR and sequencing

    2. CRISPR-Cas9 System:

      • Design guide RNAs targeting SPBC32F12.07c

      • Co-transform with Cas9 and repair template

      • Screen for successful editing events

    3. Conditional Systems for Essential Genes:

      • Implement the nmt81-promoter system for controlled gene expression

      • Create shut-off strains where the gene is under control of a repressible promoter

      • Use the rapid transcriptional induction system based on the urg1 promoter which allows induction within 30 minutes

    Validation Approaches:

    • PCR confirmation of deletion/integration

    • RT-PCR and Western blotting to confirm absence of transcript/protein

    • Complementation with wild-type gene to restore phenotype

    • Phenotypic analysis including:

      • Growth assays under various conditions

      • Cell morphology examination

      • Stress response testing

      • Cell wall integrity assessment

    For analyzing the phenotypes of SPBC32F12.07c mutants, researchers should consider methods such as bulk segregant analysis, which has been successfully used to study natural trait variations in S. pombe .

  • What experimental systems can be used to study protein-protein interactions of SPBC32F12.07c?

    In vivo Interaction Methods:

    1. Co-Immunoprecipitation (Co-IP):

      • Use tagged versions of SPBC32F12.07c (His-tagged constructs are available)

      • Immunoprecipitate using tag-specific antibodies

      • Identify interacting proteins by Western blot or mass spectrometry

    2. Yeast Two-Hybrid (Y2H):

      • Create SPBC32F12.07c bait constructs

      • Screen against S. pombe cDNA libraries

      • Validate interactions with targeted Y2H assays

    3. Proximity-Based Labeling:

      • BioID or TurboID fusion proteins to identify proximal proteins

      • APEX2-based proximity labeling

      • Analyze labeled proteins by mass spectrometry

    In vitro Interaction Methods:

    1. Pull-down Assays:

      • Express and purify recombinant SPBC32F12.07c

      • Perform pull-downs with cell lysates

      • Identify binding partners by mass spectrometry

    2. Surface Plasmon Resonance (SPR):

      • Immobilize purified SPBC32F12.07c

      • Measure binding kinetics with potential partners

      • Determine binding affinities

    Network Analysis:

    • Integrate data into interaction networks

    • Use STRING database for predicting functional partners

    • Compare with other RING finger protein networks in S. pombe

    To date, 13 interactors and 13 interactions have been identified for SPBC32F12.07c according to the BioGRID database , providing a starting point for further interaction studies.

  • How does SPBC32F12.07c compare to other characterized RING finger proteins in S. pombe and other yeasts?

    SPBC32F12.07c belongs to the RING finger family of E3 ubiquitin ligases, which represents an ancient expansion in filamentous ascomycete genomes . Comparative analysis can be performed across several dimensions:

    Structural Comparison:

    • SPBC32F12.07c contains the characteristic C3HC4 type RING finger domain

    • Like RNF115 (another RING finger protein), it likely uses the RING domain for E3 ligase activity

    • Unlike some RING fingers that function as part of Cullin-RING Ligase (CRL) complexes, SPBC32F12.07c may function independently

    Functional Comparison:

    • Other RING finger proteins in S. pombe include:

      • Mug145: A RING finger protein with potential roles in meiotic processes

      • Dma1: A RING finger protein involved in checkpoint control

      • Ubr1: A RING finger protein involved in the N-end rule pathway

    Evolutionary Conservation:

    • RING finger domains are highly conserved across eukaryotes

    • Compare homology with RNF115/BCA2/Rabring7 which has been shown to regulate multiple cellular processes

    • Analyze conservation with tools like Yogy to identify potential functional homologs

    Expression Patterns:

    • Like many RING finger proteins, SPBC32F12.07c may show condition-specific expression

    • Compare with bZIP transcription factor family members that have been extensively characterized in terms of expression patterns during vegetative growth

    This comparative approach can provide insights into potential functions and regulatory mechanisms of SPBC32F12.07c based on better-characterized RING finger proteins.

  • What methodological approaches can be used to study the potential role of SPBC32F12.07c in cellular stress responses?

    Since many RING finger E3 ubiquitin ligases are involved in stress responses , a systematic approach to determine SPBC32F12.07c's role could include:

    Expression Analysis Under Stress:

    • qRT-PCR of SPBC32F12.07c under various stresses:

      • Oxidative stress (H₂O₂, menadione)

      • Heat shock

      • Nutrient limitation

      • DNA damage (UV, MMS, etc.)

      • Cell wall stress (Calcofluor white, SDS)

    • Western blotting to determine protein levels and modifications

    Phenotypic Characterization:

    • Compare growth of wild-type and SPBC32F12.07c mutant strains under stress conditions

    • Analyze cellular morphology and viability

    • Examine cell cycle progression under stress

    Molecular Response Analysis:

    • ChIP-seq to identify stress-responsive transcription factors that bind SPBC32F12.07c promoter

    • Transcriptome analysis (RNA-seq) of wild-type vs. mutant under stress

    • Proteome analysis focusing on stress response proteins

    Functional Testing:

    • In vitro ubiquitination assays under stress-mimicking conditions

    • Identify stress-specific substrates or interacting partners

    • Test for genetic interactions with known stress response genes

    Consider following methodologies similar to those used to study RNF115, which has been shown to catalyze ubiquitination of various substrates to modulate signaling pathways in response to viral infections, autoimmunity, cell proliferation, and tumorigenesis .

  • What techniques can be applied to determine the subcellular localization of SPBC32F12.07c?

    Understanding the subcellular localization of SPBC32F12.07c is critical for inferring its function. Several complementary approaches can be used:

    Live Cell Imaging:

    • GFP/mCherry/mNeonGreen tagging of SPBC32F12.07c

    • Time-lapse microscopy to track dynamic localization

    • Colocalization with organelle markers

    Fixed Cell Methods:

    • Immunofluorescence using antibodies against SPBC32F12.07c or epitope tags

    • Electron microscopy with immunogold labeling for high-resolution localization

    • Super-resolution microscopy techniques (STORM, PALM)

    Biochemical Fractionation:

    • Cell fractionation to separate organelles

    • Western blot analysis of fractions

    • Mass spectrometry-based organelle proteomics

    Sequence-Based Prediction:

    • Analyze for localization signals (NLS, NES, transmembrane domains)

    • Use prediction algorithms for subcellular localization

    • Compare with localization patterns of homologs

    Inducible Localization Systems:

    • Anchor-Away or Anchor-Out approaches for functional validation

    • Optogenetic tools to manipulate localization

    • Rapamycin-inducible dimerization systems

    Researchers should consider that as a potential membrane-associated RING-CH (MARCH) family protein, SPBC32F12.07c might localize to cellular membranes , but experimental verification is essential.

  • How can I design experiments to identify the potential substrates of SPBC32F12.07c as an E3 ubiquitin ligase?

    Identifying the substrates of an E3 ubiquitin ligase is crucial for understanding its biological function. A multi-faceted approach includes:

    Global Proteomics Approaches:

    • Quantitative proteomics comparing wild-type and SPBC32F12.07c knockout/knockdown

    • Di-Gly remnant profiling to identify ubiquitination sites

    • Ubiquitin remnant profiling using K-ε-GG antibodies

    • Proteasome inhibition to identify accumulated substrates

    Targeted Approaches:

    • Yeast two-hybrid or BioID to identify interacting proteins

    • In vitro ubiquitination assays with candidate substrates

    • Co-immunoprecipitation followed by ubiquitin blotting

    Bioinformatic Prediction:

    • Analyze potential substrates based on motifs recognized by MARCH family E3 ligases

    • Examine expression correlation patterns

    • Compare with substrates of homologous E3 ligases

    Validation Methods:

    • Ubiquitination assays with purified components

    • Mutational analysis of predicted ubiquitination sites

    • Half-life studies of candidate substrates in wild-type vs. mutant cells

    • Rescue experiments with lysine-to-arginine mutants of substrates

    A systematic approach would be to first identify proteins whose levels or ubiquitination status change in SPBC32F12.07c mutants, then confirm direct ubiquitination in vitro, and finally validate the biological significance of this modification.

  • What are the best methods for studying the role of SPBC32F12.07c in cell cycle regulation and DNA damage response?

    S. pombe is an excellent model for studying cell cycle and DNA damage response pathways. To investigate SPBC32F12.07c's potential roles:

    Cell Cycle Analysis:

    • Synchronize cells using centrifugal elutriation, nitrogen starvation, or cdc mutants

    • Analyze SPBC32F12.07c expression and protein levels across the cell cycle

    • Examine cell cycle progression in SPBC32F12.07c mutants by flow cytometry

    • Microscopic analysis of septation index and nuclear division

    DNA Damage Response:

    • Expose cells to DNA damaging agents (UV, MMS, hydroxyurea, etc.)

    • Assess sensitivity of SPBC32F12.07c mutants

    • Monitor checkpoint activation markers (Chk1 phosphorylation)

    • Analyze DNA repair efficiency using specialized assays

    Recombination Studies:

    • Utilize established S. pombe recombination assays to study:

      • Homologous recombination efficiency

      • Non-homologous end joining

      • Single-strand annealing

    • Compare recombination rates in wild-type and SPBC32F12.07c mutant backgrounds

    Genetic Interaction Analysis:

    • Create double mutants with known cell cycle/DNA damage genes

    • Perform synthetic genetic array (SGA) analysis

    • Test for epistatic relationships

    The well-established mitotic recombination assays in S. pombe would be particularly valuable for determining if SPBC32F12.07c plays a role in DNA double-strand break repair or the resolution of stalled replication forks.

Technical and Methodological Questions

  • What are the optimal conditions for expression and purification of recombinant SPBC32F12.07c protein?

    Based on available commercial recombinant proteins and standard protocols for RING finger proteins:

    Expression Systems:

    • E. coli: BL21(DE3) or Rosetta strains are commonly used

    • Insect cells: For better folding of complex eukaryotic proteins

    • Yeast: S. cerevisiae or Pichia pastoris for authentic post-translational modifications

    Expression Constructs:

    • N-terminal His-tag is commonly used

    • Consider adding solubility tags (MBP, GST, SUMO) if solubility issues arise

    • Include TEV or PreScission protease sites for tag removal

    Optimization Parameters:

    • Induction conditions: IPTG concentration (0.1-1.0 mM)

    • Temperature: Lower temperatures (16-20°C) often improve folding

    • Duration: Extended expression (overnight) at lower temperatures

    • Media: Rich media (2xYT, TB) or minimal media for isotope labeling

    Purification Strategy:

    1. Affinity chromatography (IMAC for His-tagged proteins)

    2. Ion exchange chromatography

    3. Size exclusion chromatography for final polishing

    Buffer Considerations:

    • Include reducing agents (DTT or β-mercaptoethanol) to maintain cysteine residues

    • Consider zinc supplementation for proper RING domain folding

    • Optimize pH and ionic strength for protein stability

    • Storage buffer: Tris/PBS-based buffer with 50% glycerol at pH 8.0

    Quality Control:

    • SDS-PAGE to assess purity (>90% purity is achievable)

    • Mass spectrometry to confirm identity

    • Activity assays to verify proper folding and function

    Following reconstitution of lyophilized protein, it's recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles .

  • How can I develop specific antibodies against SPBC32F12.07c for research applications?

    Development of specific antibodies involves several critical steps:

    Antigen Design:

    • Full-length protein: Recombinant full-length SPBC32F12.07c protein is available

    • Peptide antigens: Select unique, surface-exposed regions (avoid transmembrane domains)

    • Multiple epitopes: Target at least two different regions for validation

    Production Methods:

    • Polyclonal antibodies: Immunize rabbits with recombinant protein or KLH-conjugated peptides

    • Monoclonal antibodies: Hybridoma technology using mice or rats

    • Recombinant antibodies: Phage display or yeast display technologies

    Purification Strategies:

    • Affinity purification against the immunizing antigen

    • Negative selection against related proteins

    • Cross-adsorption to remove non-specific antibodies

    Validation Methods:

    • Western blotting using wild-type and knockout/knockdown samples

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence comparing wild-type and mutant cells

    • Pre-adsorption controls with immunizing antigen

    Commercial Options:

    • Pre-made antibodies are available (e.g., CSB-PA524249XA01SXV-2)

    • Custom antibody services from specialized providers

    When developing antibodies, consider that commercially available antibodies like the rabbit polyclonal (CSB-PA524249XA01SXV-2) are purified by antigen affinity and suitable for applications like ELISA and Western blot .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.