Recombinant Schizosaccharomyces pombe Uncharacterized serine-rich protein C11G7.01 (SPAC11G7.01)

Shipped with Ice Packs
In Stock

Description

Genetic and Functional Studies

3.1. Genome-Wide Screening
Genome-wide screens in Schizosaccharomyces pombe have been conducted to identify genes involved in various cellular processes, including sensitivity to antifungal drugs . These screens often involve creating a library of deletion mutants, where each strain has a specific non-essential gene removed . By observing the phenotypes of these deletion strains under different conditions, researchers can infer the function of the deleted gene and its encoded protein.

3.2. Quantitative Fitness Analysis
Quantitative fitness analysis (QFA) of S. pombe deletion strains allows researchers to determine how the deletion of non-essential genes impacts cell fitness under different nutrient conditions or when stress is applied . This method helps identify genes that regulate transmembrane transport, transcription, chromatin organization/regulation, and vesicle-mediated transport .

3.3. TOR Signaling
The target of rapamycin (TOR) signaling network is essential for coordinating cell growth and proliferation with the nutrient environment . Studies involving the deletion of non-essential genes in S. pombe have identified links between these genes and TOR signaling pathways .

Implications in Cellular Processes

While SPAC11G7.01 is an uncharacterized protein, research involving S. pombe has identified several cellular processes it may be involved in:

  • Response to Antifungal Drugs: Deletion strains of S. pombe have been screened for altered sensitivity to antifungal drugs, suggesting the involvement of certain genes in ergosterol biosynthesis .

  • Nutrient Response: Studies have shown that the fitness of S. pombe cells is affected by nutrient availability, and genes involved in transcription and chromatin organization play a role in adapting to different nutrient conditions .

  • TOR Signaling: The TOR signaling network is crucial for coordinating cell growth and metabolism with the nutrient environment . Disruptions in TOR signaling can impact various cellular processes, including autophagy, mRNA processing, and nucleocytoplasmic transport .

  • Ran GTPase Interaction: The Ran-binding protein-1 (RanBP1) and its homologue, sbp1p, interact with the GTP-charged form of Ran GTPase, which is involved in nuclear import and export . Studies have shown that the Ran-binding domain (RBD) of sbp1p is essential for its function in fission yeast .

Experimental Techniques and Observations

5.1. Yeast Strains and Media
Schizosaccharomyces pombe strains are typically grown in rich yeast extract with supplements (YES) or Edinburgh minimal media (EMM) at controlled temperatures . Different nitrogen sources, such as ammonium, glutamate, and proline, can be used in EMM to study the effects of nutrient limitation on cell fitness .

5.2. Microscopic Analysis
Fluorescence microscopy is used to determine the subcellular distribution of proteins in transformed S. pombe cells . Epitope-tagged proteins can be visualized using indirect immunofluorescence with specific antibodies .

Data Tables

PropertyDescription
Systematic NameSPAC11G7.01
OrganismSchizosaccharomyces pombe
Protein TypeUncharacterized serine-rich protein
Length536 amino acids
Potential ModificationsPhosphorylation (due to serine residues)
Cellular Processes ImplicatedResponse to antifungal drugs, nutrient response, TOR signaling, Ran GTPase interaction

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPAC11G7.01; Uncharacterized serine-rich protein C11G7.01
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-536
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC11G7.01
Target Protein Sequence
MSFTNNTSSVDTSLSSSASSSIPASSSSAAASTSLSSSSVIPSSSSSMLSSSSATAISSS SSSSPLSSSSFTSPASSSFITSLVSSSSQQSSSSSASLTSSSSATLTSSSSASPTSSSSS HALSSSSSSLVASSSSSGMSSSSLSHSSSVPSSSSSYHSSSMTTSGLSSSASIVSSTYRD GPSIITLVSTSYVSEVVTPTTTNNWNSSSSFTSSTSSTPISSSYSSSGTLPSKSNKSSNH VGVVVGCSVAIPVGVVLILIGLGIFLWKRHQRSKRIKAERMQEVEEYGFNPNQPSNFRSP NRAPSTNNRYRGWNGSPTPAAGNNTNGRPVAPRPSAGAGGANPPAASQPGLLGGSSNSAG PIAAATAAGVGADASDAANTGGSFTRPQGARMVRPIGNPPDLSASNEAEATMPPSNGSNF SEGLSASPFESGPAVGAAGAAAEAAEHSGSGSDSYPEGPLATIPESDSESMASDLAGESS YGSRAALSSRSQSNLLSPTSTGASNQPNYSPFADNPSSSNVSIPRSSSEARRLNLF
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SPAC11G7.01 and what structural features characterize this protein?

SPAC11G7.01 is an uncharacterized serine-rich protein found in the fission yeast Schizosaccharomyces pombe. It is a full-length protein consisting of 536 amino acids that contains characteristic serine-rich regions, which are often sites for phosphorylation . The protein's high serine content suggests it may function in cellular processes that require extensive post-translational modifications, particularly phosphorylation events.

Similar to other serine-rich proteins in S. pombe, such as Srp1 and Srp2 mentioned in comparative studies, SPAC11G7.01 likely contains arginine/serine-rich (RS) domains that are common in proteins involved in RNA processing networks . These RS domains are frequent targets for specific protein kinases that regulate pre-mRNA splicing and coordinate this process with transcription.

What expression systems are most effective for producing recombinant SPAC11G7.01?

For recombinant expression of SPAC11G7.01, several expression systems can be employed, with baculovirus expression systems being particularly effective for eukaryotic proteins that require post-translational modifications . When expressing serine-rich proteins from S. pombe, researchers should consider the following methodological approach:

  • Vector selection: Choose vectors with strong promoters compatible with your expression system. For proteins requiring post-translational modifications, eukaryotic expression systems are preferable.

  • Host cell optimization: While E. coli is commonly used for protein expression, serine-rich proteins often benefit from expression in insect cells or yeast systems that can perform appropriate post-translational modifications .

  • Purification strategy: His-tagging, as used in commercial preparations of SPAC11G7.01, enables efficient purification using immobilized metal affinity chromatography (IMAC) . The following purification workflow is recommended:

Purification StepMethodBuffer ConditionsExpected Result
Initial captureIMAC50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole70-80% purity
Secondary purificationSize exclusion chromatography20 mM Tris-HCl pH 7.5, 150 mM NaCl>90% purity
Quality controlSDS-PAGE and Western blotN/ASingle band at expected MW

How can researchers verify the structural integrity of recombinant SPAC11G7.01?

Verification of recombinant SPAC11G7.01 structural integrity requires multiple analytical approaches:

  • SDS-PAGE analysis: Run purified protein alongside molecular weight markers to confirm expected size (~536 amino acids plus any tags).

  • Mass spectrometry: Perform peptide mass fingerprinting to confirm protein identity and detect any unexpected modifications or truncations.

  • Circular dichroism (CD) spectroscopy: Assess secondary structure elements, particularly important for serine-rich regions that may form specific structural motifs.

  • Phosphorylation state analysis: Since serine-rich proteins are often heavily phosphorylated, use phospho-specific antibodies or mass spectrometry to characterize the phosphorylation state, which may be critical for protein function .

  • Functional assays: Design activity tests based on predicted functions of serine-rich proteins in S. pombe, such as interactions with RNA processing machinery or specific protein kinases like Dsk1 .

What experimental design approaches are most suitable for studying SPAC11G7.01 function?

When designing experiments to study SPAC11G7.01 function, researchers should follow a systematic experimental design process :

  • Define your variables:

    • Independent variables: Experimental conditions (e.g., gene deletion, point mutations, expression levels)

    • Dependent variables: Measurable outcomes (e.g., growth rate, protein interactions, RNA processing efficiency)

    • Control variables: Factors to be held constant (e.g., temperature, media composition)

  • Formulate testable hypotheses: Based on the serine-rich nature of SPAC11G7.01 and knowledge of similar proteins, researchers might hypothesize that it functions in RNA processing pathways, potentially interacting with kinases like Dsk1 .

  • Design appropriate treatments: Consider both gain-of-function (overexpression) and loss-of-function (deletion, depletion) approaches to manipulate SPAC11G7.01 levels or activity .

  • Subject assignment: For cellular studies, use appropriate control strains alongside experimental strains. For biochemical studies, include proper negative and positive controls for each assay .

  • Measurement methods: Select appropriate techniques to measure outcomes, such as RNA-seq for transcriptome effects, co-immunoprecipitation for protein interactions, or phenotypic assays for cellular functions .

A rigorous experimental design should include appropriate controls and replicates to ensure statistical validity, with careful consideration of potential confounding variables that might affect interpretation of results.

What protein interaction methods are most effective for identifying SPAC11G7.01 binding partners?

Based on research with similar proteins in S. pombe, the following methodological approaches are recommended for identifying SPAC11G7.01 binding partners:

  • Co-immunoprecipitation (Co-IP): Generate antibodies against SPAC11G7.01 or use epitope-tagged versions to pull down protein complexes from cell lysates. This approach has successfully identified interactions between similar serine-rich proteins and kinases like Dsk1 in S. pombe .

  • Yeast two-hybrid screening: Although this technique has limitations for proteins that undergo extensive post-translational modifications, it can provide initial insights into potential interaction partners.

  • Proximity-dependent biotin identification (BioID): Fuse SPAC11G7.01 to a biotin ligase to label proximal proteins in living cells, allowing identification of both stable and transient interactions.

  • Cross-linking mass spectrometry (XL-MS): Cross-link protein complexes in vivo or in vitro, followed by mass spectrometry analysis to identify interaction partners and interfaces.

  • Interactome profiling: Similar to the RIME (Rapid Immunoprecipitation Mass spectrometry of Endogenous proteins) approach mentioned in the search results , this technique can identify multiple components of protein complexes.

When analyzing results, focus particularly on interactions with known components of RNA processing machinery and kinases that phosphorylate serine-rich domains, as these are likely functional partners based on studies of similar proteins .

How should researchers approach knockout or depletion studies of SPAC11G7.01?

When conducting knockout or depletion studies of SPAC11G7.01 in S. pombe, consider the following methodological steps:

  • Strategy selection:

    • Complete gene deletion using homologous recombination

    • Conditional expression using regulatable promoters

    • RNA interference (if available for your S. pombe strain)

    • CRISPR/Cas9-mediated disruption or repression

  • Phenotypic analysis: Based on similar proteins, examine:

    • Growth defects under various conditions

    • Cell cycle progression and morphology

    • RNA splicing efficiency using RT-PCR or RNA-seq

    • Genetic interactions with known splicing factors or serine/arginine kinases

  • Complementation testing: Reintroduce wild-type SPAC11G7.01 to confirm phenotypes are due to its absence. Consider the double-deletion approach demonstrated with Dsk1 and related kinases, which revealed synthetic lethality or severe growth defects .

  • Functional redundancy assessment: Test whether human SR proteins or other S. pombe serine-rich proteins can complement SPAC11G7.01 deletion, similar to how human SRPK1 complemented dsk1-null mutants .

How does phosphorylation affect SPAC11G7.01 function and what kinases are likely involved?

Phosphorylation likely plays a crucial role in SPAC11G7.01 function, similar to other serine-rich proteins in S. pombe. Based on research with similar proteins:

  • Potential kinases: Dsk1, a homolog of human SRPK1 (SR protein-specific kinase 1), has been shown to phosphorylate serine-rich proteins in S. pombe, including Srp1 and Srp2 . Experimental approaches to identify kinases for SPAC11G7.01 should include:

    • In vitro kinase assays with purified kinases

    • Phosphorylation site mapping using mass spectrometry

    • Genetic interaction studies with kinase mutants

  • Phosphorylation dynamics: Temporal regulation of phosphorylation may coordinate SPAC11G7.01 activity with cell cycle or stress responses. Time-course experiments combining phospho-specific antibodies or Phos-tag gels with specific cellular conditions can reveal these dynamics.

  • Functional consequences: Phosphorylation of serine-rich domains typically affects:

    • Protein localization (nuclear vs. cytoplasmic)

    • Protein-protein interactions

    • RNA binding capabilities

    • Protein stability and turnover

The table below outlines a systematic approach to study phosphorylation:

Experimental ApproachMethodExpected OutcomeLimitations
Phosphorylation site mappingLC-MS/MS analysisIdentification of specific phosphorylated residuesMay miss low abundance sites
Kinase identificationIn vitro kinase assaysDetermination of kinases that phosphorylate SPAC11G7.01May not reflect in vivo specificity
Phosphomimetic mutantsSite-directed mutagenesis (S→D/E)Function of phosphorylated proteinMay not fully mimic phosphorylation
Phosphodeficient mutantsSite-directed mutagenesis (S→A)Function when phosphorylation is preventedMay disrupt structure

What transcriptional networks might involve SPAC11G7.01 in S. pombe?

To investigate the potential role of SPAC11G7.01 in transcriptional networks:

  • Chromatin immunoprecipitation sequencing (ChIP-seq): Use epitope-tagged SPAC11G7.01 to identify genomic binding sites. This approach has been successful with other transcription factors like SP1 .

  • RNA sequencing after perturbation: Compare transcriptomes of wild-type and SPAC11G7.01 knockout/knockdown strains to identify affected genes. Analyze the data for:

    • Differentially expressed genes

    • Alternative splicing events

    • Enriched sequence motifs in affected genes

    • Gene ontology enrichment among affected transcripts

  • Integration with existing databases: Cross-reference findings with S. pombe transcription unit databases such as those shown in search result to identify patterns in affected genes.

  • Co-expression analysis: Identify genes with expression patterns correlated with SPAC11G7.01 across different conditions to infer functional relationships.

  • Genetic interaction screening: Systematic genetic interaction mapping can reveal functional relationships between SPAC11G7.01 and known transcriptional regulators or RNA processing factors.

How can researchers address the challenges of studying an uncharacterized protein like SPAC11G7.01?

Studying uncharacterized proteins requires a systematic approach combining multiple methodologies:

  • Comparative genomics strategy:

    • Identify orthologs in related species through sequence analysis

    • Examine conservation patterns of specific domains

    • Infer function from better-characterized homologs

  • Domain-based predictions:

    • Analyze serine-rich regions for patterns corresponding to known functional motifs

    • Predict subcellular localization using computational tools

    • Identify potential phosphorylation sites and kinase recognition motifs

  • High-throughput screening approaches:

    • Synthetic genetic array analysis to identify genetic interactions

    • Systematic localization studies under different conditions

    • Chemical genetic screening to identify conditions affecting mutant phenotypes

  • Integrative data analysis:

    • Combine proteomic, transcriptomic, and genetic data

    • Use network analysis to position SPAC11G7.01 in cellular pathways

    • Develop testable hypotheses based on network positioning

  • Model validation: Design targeted experiments to test specific hypotheses generated from high-throughput and computational approaches.

What are the common challenges in purifying recombinant SPAC11G7.01 and how can they be addressed?

Purification of serine-rich proteins like SPAC11G7.01 presents several challenges:

  • Solubility issues: Serine-rich proteins may form aggregates during expression. Methodological solutions include:

    • Optimizing induction conditions (lower temperature, reduced inducer concentration)

    • Including solubility-enhancing fusion tags (SUMO, MBP, or GST)

    • Using specialized buffer systems with stabilizing agents

  • Phosphorylation heterogeneity: Recombinant expression may result in heterogeneous phosphorylation states. Address this by:

    • Co-expressing with relevant kinases

    • Treating with phosphatases for uniformly dephosphorylated preparation

    • Using Phos-tag SDS-PAGE to assess phosphorylation state

  • Proteolytic sensitivity: Regions between structured domains may be susceptible to proteolysis. Preventive measures include:

    • Adding protease inhibitors throughout purification

    • Reducing purification time and temperature

    • Identifying and mutating protease-sensitive sites

  • Yield optimization: For higher protein yields, consider:

    • Screening multiple expression systems (bacterial, yeast, insect, mammalian)

    • Optimizing codon usage for the expression host

    • Scaling up culture volumes or using high-density fermentation

How can researchers design effective functional assays for SPAC11G7.01?

When designing functional assays for an uncharacterized protein like SPAC11G7.01, consider these methodological approaches:

  • In vitro biochemical assays:

    • RNA binding assays if the protein is predicted to interact with RNA

    • Phosphorylation assays with candidate kinases like Dsk1

    • Protein-protein interaction assays with suspected partners

  • Cellular localization studies:

    • Fluorescent protein tagging to track localization

    • Immunofluorescence with specific antibodies

    • Analysis of localization changes during cell cycle or stress conditions

  • Genetic manipulation experiments:

    • Phenotypic analysis of deletion mutants

    • Overexpression studies to identify gain-of-function effects

    • Complementation tests with mutant variants

  • Transcriptome and proteome analysis:

    • RNA-seq to identify affected transcripts

    • Ribosome profiling to assess translation effects

    • Quantitative proteomics to identify protein level changes

Design assays based on predicted functions from sequence analysis and knowledge of similar proteins, while remaining open to unexpected functions that may emerge from unbiased screening approaches.

What considerations are important when interpreting phylogenetic analyses of SPAC11G7.01?

When conducting and interpreting phylogenetic analyses of SPAC11G7.01:

How might integrating multi-omics data advance our understanding of SPAC11G7.01 function?

A comprehensive multi-omics approach can uncover the function of uncharacterized proteins like SPAC11G7.01:

  • Integrated data collection strategy:

    • Transcriptomics: RNA-seq to identify affected genes in knockout/knockdown strains

    • Proteomics: Interactome mapping through IP-MS and phosphoproteomics

    • Genomics: ChIP-seq to identify genomic binding sites

    • Metabolomics: Detection of metabolic changes in mutant strains

  • Data integration methodologies:

    • Network analysis to identify functional modules

    • Machine learning approaches to predict functions from multi-omics signatures

    • Correlation analysis across different omics layers

    • Pathway enrichment analysis across integrated datasets

  • Validation experiments:

    • Targeted experiments to confirm predictions from integrated analysis

    • CRISPR screening focused on pathway components identified through integration

    • Synthetic genetic array analysis guided by multi-omics predictions

Successful integration requires careful experimental design, consistent sample preparation, appropriate normalization methods, and sophisticated computational approaches to handle the complexity of multi-omics data.

What are the most promising approaches for determining SPAC11G7.01 structure and how would this inform function?

Structural biology approaches for SPAC11G7.01 should account for challenges posed by serine-rich proteins:

Structural insights would inform mechanistic hypotheses, guide mutational studies, and potentially reveal unexpected functions through structural homology to characterized proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.