Recombinant Schizosaccharomyces pombe Uncharacterized TLC domain-containing protein C17A2.02c (SPAC17A2.02c)

Shipped with Ice Packs
In Stock

Description

Overview of SPAC17A2.02c/Tlc4

SPAC17A2.02c is encoded by the fission yeast Schizosaccharomyces pombe genome (UniProt: O13752) . Key features include:

  • Gene locus: SPAC17A2.02c (chromosome I)

  • Protein size: 290 amino acids (~33 kDa)

  • Domain architecture: TRAM/LAG1/CLN8 (TLC) domain, seven transmembrane regions

  • Conservation: Homologs exist across eukaryotes, including human TLCD4 and Saccharomyces cerevisiae YPR114W .

Key Research Findings:

  • Nuclear envelope integrity:

    • Overexpression of Tlc4 suppresses synthetic lethality in lem2Δ bqt4Δ mutants, rescuing NE defects (e.g., nuclear protein leakage) .

    • Localizes to the NE and Golgi, with Golgi localization linked to its suppressor activity .

  • Non-catalytic role: Unlike CerS proteins, Tlc4 does not synthesize ceramides but may regulate lipid transport or membrane dynamics .

  • Genetic interactions:

    • Epistatic with erg2 (ergosterol biosynthesis) and cnx1 (calnexin) .

    • Deletion (tlc4Δ) does not impair growth under standard conditions but exacerbates NE defects in stress .

Table 2: Functional Comparison with CerS Proteins

FeatureTlc4 (SPAC17A2.02c)CerS Proteins (e.g., Lag1)
Catalytic activityNon-catalytic Ceramide synthesis
LocalizationNE, ER, Golgi ER
Genetic suppressionRescues lem2Δ bqt4Δ No direct link to NE integrity

Production and Availability

Recombinant Tlc4 is produced in E. coli expression systems for research applications :

  • Expression system: In vitro E. coli

  • Purity: >90% (SDS-PAGE verified)

  • Product codes: CSB-CF519299SXV (Cusabio) , CSB-CF519299SXV (Colorectal Research)

Research Significance

Tlc4 represents a novel class of TLCD proteins with roles beyond lipid synthesis:

  • Membrane biology: Links ER-Golgi-NE trafficking to membrane integrity .

  • Disease relevance: Human TLCD4 homologs are associated with metabolic and neurodegenerative disorders .

Outstanding Questions

  • Does Tlc4 interact directly with ceramides or other lipids?

  • What molecular mechanisms underlie its Golgi-dependent NE rescue?

  • How do TLCD proteins influence organelle crosstalk in higher eukaryotes?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
SPAC17A2.02c; Uncharacterized TLC domain-containing protein C17A2.02c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC17A2.02c
Target Protein Sequence
MSSAVTPSDQGLLPRGPIALEEFVKPFCDRFGLTKLPRHMHVILLSALFYQIINILSPVI SRHLSTHYAKLSKKTRLNWDAHVVSSVQSIVLICLGYTCLKEVNAFPDKLFGYSVVAGDI YALTAGYFVWDLYITVRYVHITGIGFVIHAIAALFVITFSYRPYLMYYGPTYLSWELSTP FLNIHYFLDKTNRTGSKFQMINGFILIVTFICVRIAWGWFSAYSTAIEILNHINVAPWAL SLFYLAANMSLNCLNLFWVSKMIDAIRRRAHGEKKSTPLQVTSEYAKKNI
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and cellular localization of the TLC domain-containing protein C17A2.02c in S. pombe?

The TLC (TRAM, LAG1, and CLN8 homology) domain-containing protein C17A2.02c is predicted to contain at least 5 transmembrane alpha-helices, characteristic of the TLC domain family. These proteins typically function as integral components of cellular membranes . Based on structural homology with other TLC domain-containing proteins, C17A2.02c likely adopts a membrane-spanning conformation with multiple transmembrane segments. The protein is expected to be primarily localized in cellular membranes, potentially including the endoplasmic reticulum, Golgi apparatus, or plasma membrane, which aligns with the known functions of other TLC domain-containing proteins in lipid trafficking, metabolism, or sensing .

How can researchers distinguish between the TLC domain-containing protein C17A2.02c and other TLC domain proteins in S. pombe?

Distinguishing C17A2.02c from other TLC domain proteins requires a multi-faceted approach:

  • Sequence alignment analysis: Perform detailed sequence comparisons between C17A2.02c and other TLC domain proteins using multiple sequence alignment tools. Focus particularly on regions outside the conserved TLC domain to identify unique sequences.

  • Expression pattern profiling: Monitor expression patterns under various conditions such as cell cycle stages, stress responses, and nutritional states, as expression profiles often differ between functionally distinct proteins.

  • Protein-specific antibody generation: Develop antibodies against unique epitopes in C17A2.02c, typically in the non-conserved regions, for specific detection in immunoblotting and immunofluorescence assays.

  • Gene knockout/silencing specificity: When generating knockout strains or using RNA interference techniques, confirm specificity by demonstrating that only C17A2.02c expression is affected without altering the expression of other TLC domain proteins.

The HGNC Comparison of Orthology Predictions (HCOP) tool can be valuable for identifying orthologous proteins across species, providing additional context for understanding the specific evolutionary relationships of C17A2.02c .

What are the predicted functional roles of TLC domain-containing proteins that might apply to C17A2.02c?

Based on the conserved functions of TLC domain-containing proteins, C17A2.02c may be involved in several cellular processes:

  • Lipid trafficking and metabolism: Many TLC domain proteins, such as Lag1p and Lac1p, are essential for acyl-CoA-dependent ceramide synthesis, suggesting C17A2.02c might participate in sphingolipid metabolism or transport .

  • Membrane organization: As an integral membrane protein, it likely contributes to membrane structure and organization, potentially participating in specialized membrane domains.

  • Cellular signaling: TLC domain proteins can function as lipid sensors, suggesting C17A2.02c might play a role in cellular signaling pathways responsive to lipid composition changes.

  • Protein transport: Similar to TRAM (translocating chain-associating membrane protein), which is a subunit of the translocon, C17A2.02c might function in protein translocation across membranes .

Understanding these potential functions provides direction for experimental designs aimed at characterizing the specific role of C17A2.02c in S. pombe.

What genetic modification approaches are most effective for studying the uncharacterized TLC domain-containing protein C17A2.02c in S. pombe?

For effective genetic modification of C17A2.02c in S. pombe, consider these methodological approaches:

  • Gene deletion/knockout strategies:

    • Use homologous recombination with selection markers (e.g., antibiotic resistance genes) flanked by sequences homologous to regions surrounding the C17A2.02c gene.

    • Employ CRISPR-Cas9 system adapted for S. pombe to create precise deletions or mutations.

  • Protein tagging methods:

    • C-terminal or N-terminal tagging with fluorescent proteins (GFP, mCherry) for localization studies, considering the transmembrane nature of TLC proteins.

    • Epitope tagging (e.g., FLAG, HA, or TAP) for protein purification and interaction studies.

  • Conditional expression systems:

    • Utilize the nmt1 promoter series (strong, medium, or weak) for thiamine-repressible expression.

    • Implement temperature-sensitive alleles for conditional inactivation studies.

  • Heterologous expression:

    • Express C17A2.02c in other model organisms for comparative functional studies.

These approaches can be combined with the meiotic recombination techniques described for S. pombe to generate desired strains through crossing . When designing experiments, consider that as an uncharacterized protein, initial phenotypic effects of modifications might be subtle or context-dependent.

How can researchers effectively assess protein-protein interactions involving C17A2.02c in the context of S. pombe membranes?

Studying protein-protein interactions for a membrane-bound protein like C17A2.02c requires specialized approaches:

  • Membrane-specific co-immunoprecipitation (co-IP):

    • Use mild detergents (e.g., digitonin, CHAPS, or DDM) for membrane solubilization while preserving protein interactions.

    • Employ crosslinking agents (e.g., DSP or formaldehyde) prior to lysis to stabilize transient interactions.

    • Tag C17A2.02c with epitopes positioned to avoid disrupting transmembrane domains.

  • Proximity-based labeling techniques:

    • BioID or TurboID fusion proteins to biotinylate proximal proteins in living cells.

    • APEX2 fusion for proximity-dependent biotinylation, particularly useful for membrane proteins.

  • Split-protein complementation assays:

    • BiFC (Bimolecular Fluorescence Complementation) with membrane-optimized fluorescent protein fragments.

    • Split-ubiquitin membrane yeast two-hybrid system specifically designed for membrane proteins.

  • Fluorescence-based interaction analyses:

    • FRET (Förster Resonance Energy Transfer) between C17A2.02c and potential interacting partners.

    • FLIM (Fluorescence Lifetime Imaging Microscopy) to detect interactions with minimal disruption to membrane architecture.

When interpreting results, consider control experiments with other TLC domain-containing proteins to differentiate between domain-specific and protein-specific interactions. Additionally, validation across multiple techniques is essential due to the challenges inherent in studying membrane protein interactions.

What approaches can be used to determine if C17A2.02c is involved in lipid trafficking or metabolism in S. pombe?

To investigate the potential role of C17A2.02c in lipid metabolism or trafficking, researchers should consider these methodological approaches:

  • Lipidomic analysis:

    • Compare lipid profiles between wild-type and C17A2.02c knockout/overexpression strains using mass spectrometry-based lipidomics.

    • Focus on sphingolipids, ceramides, and complex lipids, given the known functions of other TLC domain proteins .

    • Analyze changes under different growth conditions or stress scenarios.

  • Fluorescent lipid trafficking assays:

    • Use fluorescently labeled lipids (NBD-ceramide, BODIPY-sphingomyelin) to track lipid movement in cells.

    • Compare trafficking kinetics between wild-type and mutant cells using time-lapse microscopy.

    • Employ photoactivatable lipid analogs for pulse-chase experiments.

  • Genetic interaction studies:

    • Create double mutants with known lipid metabolism genes.

    • Perform synthetic genetic array (SGA) analysis to identify genetic interactions.

    • Test for rescue of phenotypes using homologs like Lag1p or Lac1p, which are involved in ceramide synthesis .

  • Biochemical assays:

    • Measure the activities of key lipid-metabolizing enzymes in the presence and absence of C17A2.02c.

    • Reconstitute purified C17A2.02c in liposomes to test for direct effects on lipid dynamics.

A comprehensive approach combining these methods will provide robust evidence for the specific role of C17A2.02c in lipid biology within S. pombe.

How can researchers develop a high-throughput screening system to identify compounds that modulate C17A2.02c activity?

Developing a high-throughput screening system for compounds that modulate C17A2.02c requires careful experimental design:

  • Reporter-based functional assays:

    • Create fusion constructs linking C17A2.02c activity to measurable outputs (fluorescence, luminescence).

    • Design split-reporter systems where reporter activation depends on C17A2.02c function.

    • Develop growth-based screens where C17A2.02c function is linked to survival under specific conditions.

  • Membrane integrity and lipid distribution screens:

    • Implement fluorescent lipid probes whose distribution changes with C17A2.02c activity.

    • Use membrane potential-sensitive dyes if C17A2.02c affects membrane properties.

    • Develop high-content imaging workflows to analyze multiple parameters simultaneously.

  • Heterologous expression platforms:

    • Express C17A2.02c in bacteria (using membrane targeting systems like INP) for more accessible screening.

    • Adapt yeast surface display techniques to present functional C17A2.02c domains.

    • Consider microfluidic platforms for increased throughput and reduced reagent consumption.

  • Data analysis and validation pipeline:

    • Implement machine learning algorithms to identify subtle phenotypic changes.

    • Develop secondary validation assays in intact S. pombe cells.

    • Create dose-response profiles for promising compounds.

This approach enables systematic screening of chemical libraries while maintaining biological relevance to the native function of C17A2.02c in S. pombe.

What strategies can researchers employ to resolve the 3D structure of the TLC domain-containing protein C17A2.02c?

Determining the 3D structure of membrane proteins like C17A2.02c presents significant challenges requiring specialized approaches:

  • X-ray crystallography optimization:

    • Screen detergents systematically (maltoside series, fos-choline series) for optimal protein extraction and stability.

    • Use lipidic cubic phase (LCP) or bicelle crystallization methods specifically designed for membrane proteins.

    • Consider fusion protein strategies (T4 lysozyme, BRIL) to increase soluble domains for crystal contacts.

    • Implement surface entropy reduction mutations to promote crystallization.

  • Cryo-electron microscopy (cryo-EM) approaches:

    • Optimize protein purification for homogeneity and conformational stability.

    • Consider nanodisc reconstitution to maintain a native-like lipid environment.

    • Implement focused refinement strategies for flexible regions.

    • Use computational particle sorting to identify discrete conformational states.

  • Integrative structural biology methods:

    • Combine lower-resolution techniques (SAXS, SANS) with computational modeling.

    • Use cross-linking mass spectrometry (XL-MS) to define distance constraints.

    • Employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamics and accessibility.

    • Validate models with site-directed mutagenesis and functional assays.

  • NMR spectroscopy strategies:

    • Consider solid-state NMR for full-length protein in membrane mimetics.

    • Use solution NMR for soluble domains or fragments.

    • Implement selective isotope labeling strategies to simplify spectra.

Success may require iterative optimization and potentially focusing initially on specific domains before attempting the full-length protein structure.

How can researchers distinguish the specific function of C17A2.02c from other TLC domain proteins in S. pombe using transcriptomic approaches?

Differentiating the function of C17A2.02c from other TLC domain proteins through transcriptomics requires sophisticated experimental design and analysis:

  • Temporal transcriptomic profiling:

    • Implement time-course RNA-seq experiments comparing wild-type, C17A2.02c deletion, and other TLC protein mutants under various conditions.

    • Use the MultiRNAflow R package to analyze temporal expression patterns, identifying genes specifically affected by C17A2.02c manipulation .

    • Compare expression patterns during different growth phases, stress responses, and developmental stages.

  • Conditional expression systems coupled with RNA-seq:

    • Employ titratable or inducible expression systems to create expression gradients.

    • Analyze dose-dependent transcriptional responses to distinguish direct from indirect effects.

    • Implement rapid protein degradation systems (e.g., auxin-inducible degron) for acute depletion studies.

  • Single-cell transcriptomics:

    • Apply scRNA-seq to detect cell-population-specific functions that might be masked in bulk analysis.

    • Track transcriptional heterogeneity in response to C17A2.02c perturbation.

    • Identify cell states particularly dependent on C17A2.02c function.

  • Integrative network analysis:

    • Construct gene regulatory networks specific to each TLC protein.

    • Identify unique network motifs and hub genes associated specifically with C17A2.02c.

    • Validate key network connections through chromatin immunoprecipitation or genetic interaction studies.

The resulting data can be presented in tables comparing differentially expressed genes across TLC protein mutants, revealing unique gene sets and pathways specifically regulated by C17A2.02c.

How can orthology analysis help predict the function of the uncharacterized C17A2.02c protein in S. pombe?

Orthology analysis provides valuable insights into the function of uncharacterized proteins through evolutionary relationships:

  • Comprehensive orthology identification:

    • Utilize the HGNC Comparison of Orthology Predictions (HCOP) tool to identify orthologous proteins across species .

    • Apply multiple orthology detection algorithms (reciprocal best hits, phylogenetic approaches, synteny analysis) to increase confidence.

    • Create custom BLAST searches against organisms with well-characterized TLC domain proteins.

  • Functional inference through comparative genomics:

    • Analyze phenotypes of orthologous gene knockouts in model organisms.

    • Compare gene neighborhood conservation (synteny) across species to identify functional associations.

    • Evaluate evolutionary rate patterns to identify functional constraints.

  • Domain architecture analysis:

    • Compare the organization of TLC and additional domains across orthologs.

    • Identify species-specific adaptations in domain structure.

    • Map known mutations or functional residues from characterized orthologs to C17A2.02c.

  • Experimental validation of predicted functions:

    • Test for functional complementation by expressing C17A2.02c in organisms with mutations in orthologous genes.

    • Compare subcellular localization patterns of orthologs across species.

    • Validate predicted protein-protein interactions conserved between orthologs.

This comprehensive approach leverages evolutionary conservation to develop testable hypotheses about C17A2.02c function based on better-characterized orthologs in other species.

What techniques can be used to investigate whether C17A2.02c interacts with Sib1, Sib2, or Sib3 proteins in S. pombe?

Investigating potential interactions between C17A2.02c and the Sib proteins (involved in ferrichrome-mediated processes) requires specialized approaches for membrane-associated proteins:

  • In vivo interaction detection methods:

    • Bimolecular Fluorescence Complementation (BiFC) with split fluorescent proteins fused to C17A2.02c and Sib proteins.

    • Förster Resonance Energy Transfer (FRET) using appropriate fluorophore pairs.

    • Proximity Ligation Assay (PLA) for detecting interactions with high sensitivity and spatial resolution.

  • Co-immunoprecipitation and pull-down strategies:

    • Optimize membrane protein extraction using detergents that preserve protein-protein interactions.

    • Implement crosslinking prior to cell lysis to stabilize transient interactions.

    • Use reciprocal tagging (both C17A2.02c and Sib proteins) to validate interactions.

  • Genetic interaction analysis:

    • Create double knockouts/knockdowns of C17A2.02c with each Sib gene.

    • Analyze synthetic phenotypes (growth, morphology, stress response).

    • Test for genetic suppression or enhancement under iron-limited conditions (where Sib proteins function) .

  • Functional colocalization studies:

    • Perform high-resolution colocalization imaging under varying iron conditions.

    • Implement live-cell tracking to monitor dynamic colocalization during iron response.

    • Analyze protein distribution changes when partner proteins are absent or overexpressed.

Given that Sib proteins are involved in ferrichrome synthesis and iron metabolism in S. pombe , interactions with C17A2.02c might suggest a potential role in iron-responsive lipid metabolism or membrane organization during iron limitation.

How might structural characterization of C17A2.02c contribute to our understanding of TLC domain proteins implicated in human diseases?

Structural insights into C17A2.02c have significant implications for understanding human disease-associated TLC domain proteins:

  • Comparative structural modeling:

    • Using the resolved structure of C17A2.02c as a template to model human TLC domain proteins like CLN8, mutations in which cause Northern epilepsy syndrome .

    • Identifying conserved structural elements across species that might represent functionally critical regions.

    • Mapping disease-causing mutations onto conserved structural features to understand molecular mechanisms.

  • Structure-guided drug design applications:

    • Identifying potential binding pockets in human orthologs based on C17A2.02c structure.

    • Developing screening strategies for compounds that might modulate TLC domain protein function.

    • Using structural information to predict the impact of patient-specific mutations.

  • Mechanism elucidation:

    • Understanding how transmembrane helices in TLC domains coordinate to perform their function.

    • Determining structural changes associated with lipid binding or transport.

    • Identifying interaction interfaces with partner proteins that might be conserved in human orthologs.

  • Therapeutic strategy development:

    • Designing protein engineering approaches to correct structural defects in disease-associated variants.

    • Developing peptide-based inhibitors or activators based on structural insights.

    • Creating screening assays for compounds that stabilize destabilizing mutations in human orthologs.

This research bridges basic science and translational applications, potentially opening new therapeutic avenues for diseases associated with TLC domain protein dysfunction.

What methods can researchers use to integrate C17A2.02c functional studies with broader systems biology approaches in S. pombe?

Integrating C17A2.02c studies with systems biology requires multi-omics approaches and network analysis:

  • Multi-omics data integration:

    • Combine transcriptomics, proteomics, lipidomics, and metabolomics data from C17A2.02c perturbation experiments.

    • Implement temporal sampling to capture dynamic network responses.

    • Use computational methods to identify correlated changes across different data types.

  • Network reconstruction and analysis:

    • Build protein-protein interaction networks including C17A2.02c using experimental data.

    • Construct gene regulatory networks to identify transcription factors responding to C17A2.02c perturbation.

    • Develop lipid-protein interaction networks to map the impact on membrane organization.

  • Phenotypic profiling at multiple scales:

    • Implement high-content imaging to capture cellular phenotypes.

    • Use microfluidics for single-cell growth and morphology tracking.

    • Apply metabolic flux analysis to understand impact on cellular metabolism.

  • Mathematical modeling and simulation:

    • Develop ordinary differential equation models of pathways involving C17A2.02c.

    • Implement constraint-based modeling to predict metabolic consequences.

    • Create agent-based models for membrane dynamics incorporating C17A2.02c function.

This integrated approach positions C17A2.02c research within the broader context of cellular function, revealing emergent properties and system-level impacts that might not be apparent from isolated studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.