Recombinant Schizosaccharomyces pombe Uncharacterized transcriptional regulatory protein C1773.12 (SPBC1773.12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request; however, additional charges will apply. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPBC1773.12; Uncharacterized transcriptional regulatory protein C1773.12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-594
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC1773.12
Target Protein Sequence
MVPIKKISTACDLCRQRKLRCNGELPKCQNCVVYSETCKYNKRKRVKKPNVDKDDPHIVV GQPPVKKSTAGITREYTEMIELRNHIITLSKRSVNMESRIDDMLNLLNYDLSEKRETSNE IPSLVQQIQNCGFLIDEKMRRYPGIFQIHPKDYTMNDLFPQSFPTWISVYRNVPEKAWAN RCVEWYFRYINSCWPLFDLENFMDLFDNFYSDKEKTKGAWVVSFYAIMALAVSRSKRKDK EKISKSLFSTSWFLVQKPGFFLTARLDKIQALTIMIQFCAHLSLYNLCKVLCGQMCLMVK DLDLHKEATNPNVDIEVDELNRRVFWTCYIFETTTSLIFGTPPELGDLEIDCQLPSMDVL PRFTESSQGGIVFCSEIQLTIIKNEIRKKIYKCLASASEEVYKEAVLSIRGKLIVWERNL PDELKQYYDVIKLNGTIPKNVDFENQHIFTACVEIYLSYCITQLYFYDPLTNYETCLEIA RKAADAIRSYFMVIEPIFKKICYLWLFLYCPFTPFQILFSNILKMEKGTSDEKIEDLDRM YSLYRFFVEMKEINGEFADKLSRVALDCIDAAEHYLELKSSVGSNIFELESLLV
Uniprot No.

Target Background

Database Links
Subcellular Location
Nucleus membrane; Single-pass membrane protein. Nucleus, nucleolus.

Q&A

What is the predicted function of SPBC1773.12 in S. pombe?

SPBC1773.12 is annotated as an uncharacterized transcriptional regulatory protein in Schizosaccharomyces pombe. Based on sequence analysis and structural predictions, it likely functions as a transcription factor involved in gene expression regulation. While its specific targets remain unidentified, it may be related to the nearby gene SPBC1773.13 (aro8+), which has been shown to be regulated under general amino acid control (GAAC) conditions in S. pombe. Studies have demonstrated that aro8+ expression increases significantly (6.9-fold) when GAAC is activated, suggesting that SPBC1773.12 might play a role in amino acid metabolism regulation or stress response pathways . Motif analysis suggests the presence of DNA-binding domains characteristic of transcriptional regulators, but experimental validation through ChIP-seq or similar approaches would be necessary to confirm binding sites and regulatory targets.

What experimental systems are available for studying SPBC1773.12 expression?

Several established S. pombe expression systems can be utilized to study SPBC1773.12:

  • nmt1 Promoter System: This thiamine-repressible promoter system allows controlled expression but requires 14-20 hours for full induction after thiamine removal .

  • urg1 Promoter System: For faster induction, the urg1 promoter system enables expression within 30 minutes, similar to the S. cerevisiae GAL induction system .

  • Constitutive Expression Systems: For stable expression, promoters like adh1+ can be used.

Expression SystemInduction TimeRegulation MethodStrength
nmt1 (full strength)14-20 hoursThiamine repressionHigh
nmt1 (medium strength)14-20 hoursThiamine repressionMedium
nmt1 (low strength)14-20 hoursThiamine repressionLow
urg1~30 minutesUracil inductionMedium
adh1N/A (constitutive)NoneMedium

For studying natural expression patterns, genomic tagging approaches using homologous recombination can maintain native promoter regulation while adding epitope tags or fluorescent markers for detection .

How can I determine if SPBC1773.12 has homologs in other organisms?

To identify potential homologs of SPBC1773.12 in other organisms:

  • Sequence Analysis: Use BLAST or similar tools to search for sequence homology across protein databases.

  • Domain Architecture Analysis: Identify conserved domains and search for proteins with similar domain organization.

  • Phylogenetic Analysis: Construct phylogenetic trees of similar proteins to determine evolutionary relationships.

  • Structural Prediction: Use tools like AlphaFold to predict protein structure and compare with known structures.

What phenotypes might result from SPBC1773.12 deletion in S. pombe?

Phenotypic analysis of SPBC1773.12 deletion mutants should include:

  • Growth Rate Assessment: Monitor growth curves under standard conditions (YES or EMM media at 30°C) and stress conditions (nutrient limitation, temperature stress, oxidative stress).

  • Cell Morphology Analysis: Examine cell shape, size, and division patterns using microscopy.

  • Cell Cycle Analysis: Determine if deletion affects cell cycle progression using flow cytometry.

  • Transcriptome Analysis: Perform RNA-seq to identify genes with altered expression in the deletion strain.

Based on studies of related proteins in S. pombe, if SPBC1773.12 is involved in amino acid metabolism like the nearby aro8+ gene, deletion might cause:

  • Growth defects under amino acid limitation

  • Altered general amino acid control (GAAC) response

  • Sensitivity to translation inhibitors

For transcriptome analysis, follow protocols similar to those used in S. pombe GAAC studies, where mutants were grown to mid-log phase and RNA was prepared from 5-10 OD pellets using glass beads, treated with DNase, reverse transcribed, and analyzed by qPCR .

How can I generate tagged versions of SPBC1773.12 for localization studies?

To generate tagged versions of SPBC1773.12 for localization and interaction studies:

  • C-terminal Tagging: Use PCR-based homologous recombination to add GFP, mCherry, or epitope tags (HA, Myc, FLAG) to the C-terminus. This approach maintains native promoter control.

Protocol Outline:

  • Design primers with 80bp homology to regions flanking the stop codon

  • Amplify tag sequence with selectable marker

  • Transform S. pombe cells with linear DNA fragment

  • Select transformants on appropriate media

  • Confirm integration by PCR and expression by Western blot

  • N-terminal Tagging: If C-terminal tagging disrupts protein function, use a similar approach for N-terminal tagging, though this may affect protein regulation.

  • Conditional Expression: For proteins with essential functions, use the nmt1 or urg1 promoter systems described earlier.

For visualization, standard fluorescence microscopy protocols for S. pombe should be followed, with DAPI staining for nuclear localization. Co-localization studies with known nuclear markers can help determine subnuclear localization patterns typical of transcription factors .

How does cellular stress affect SPBC1773.12 expression and function?

To investigate stress response:

  • Stress Conditions to Test:

    • Nutrient limitation (nitrogen, carbon)

    • Oxidative stress (H₂O₂, menadione)

    • DNA damage (UV, MMS, hydroxyurea)

    • Heat shock

    • Osmotic stress (sorbitol, NaCl)

  • Expression Analysis:

    • RT-qPCR to measure SPBC1773.12 mRNA levels

    • Western blotting of tagged SPBC1773.12

    • Fluorescence microscopy for localization changes

  • Functional Assessment:

    • Compare wild-type and deletion strain growth under stress

    • Analyze global gene expression changes by RNA-seq

Based on knowledge of related pathways, SPBC1773.12 might be involved in the general amino acid control (GAAC) pathway. If so, amino acid starvation conditions would be particularly relevant to test, similar to experiments where S. pombe cells were treated with 3-aminotriazole (3-AT) to induce the GAAC response . For RNA analysis, use protocols similar to those described for GAAC studies, including RNA preparation from mid-log phase cultures and RT-qPCR for specific target genes.

How can ChIP-seq be optimized for studying SPBC1773.12 binding sites?

Optimizing ChIP-seq for SPBC1773.12 in S. pombe requires careful consideration of several parameters:

  • Crosslinking Optimization:

    • Test different formaldehyde concentrations (1-3%)

    • Optimize crosslinking time (5-20 minutes)

    • Consider dual crosslinking with DSG for improved protein-protein crosslinking

  • Chromatin Fragmentation:

    • Optimize sonication conditions for 200-500bp fragments

    • Consider enzymatic fragmentation alternatives

  • Antibody Selection:

    • For tagged proteins: use high-quality commercial antibodies against the tag

    • For native protein: develop and validate specific antibodies

  • Controls and Normalization:

    • Include input controls

    • Use non-tagged strains as negative controls

    • Consider spike-in normalization for quantitative comparisons

  • Sequencing Considerations:

    • Aim for 20-30 million reads per sample

    • Use paired-end sequencing for improved mapping

For data analysis, established pipelines for S. pombe ChIP-seq should be followed, including quality control, mapping to the S. pombe genome, peak calling using MACS2 or similar algorithms, and motif discovery using MEME or similar tools. Integration with RNA-seq data can help identify direct regulatory targets .

What role might SPBC1773.12 play in the DNA damage response pathway?

To investigate SPBC1773.12's potential role in DNA damage response:

  • Sensitivity Assays:

    • Compare growth of wild-type and SPBC1773.12Δ strains when exposed to:

      • UV radiation

      • Methyl methanesulfonate (MMS)

      • Hydroxyurea (HU)

      • Camptothecin (CPT)

      • Ionizing radiation

  • Genetic Interaction Analysis:

    • Generate double mutants with known DNA repair genes

    • Test synthetic lethality or suppression

    • Develop a genetic interaction map

  • Damage-Induced Expression:

    • Monitor SPBC1773.12 expression changes after DNA damage

    • Track protein localization changes using fluorescently tagged strains

  • Recombination Assays:

    • Utilize established S. pombe recombination assays to measure homologous recombination rates

    • Consider intrachromosomal recombination assays using his3+ and ura4 reporters

S. pombe has powerful assays for studying DNA damage responses, including systems for studying double-strand break repair and mitotic recombination . The intrachromosomal deletion assay with his3+ and truncated ura4 alleles could be particularly useful to determine if SPBC1773.12 affects recombination rates, especially if it's involved in transcriptional regulation of DNA repair genes.

How can proteomics approaches identify SPBC1773.12 interaction partners?

For comprehensive identification of SPBC1773.12 interaction partners:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged SPBC1773.12 (e.g., TAP-tag, FLAG-tag)

    • Optimize lysis conditions to preserve interactions

    • Perform tandem affinity purification

    • Analyze by LC-MS/MS

    • Use SAINT or similar algorithms for interaction scoring

  • Proximity-Based Labeling:

    • Generate BioID or TurboID fusion with SPBC1773.12

    • Induce biotinylation in vivo

    • Purify biotinylated proteins

    • Identify by mass spectrometry

  • Co-Immunoprecipitation (Co-IP):

    • For validation of specific interactions

    • Use reciprocal tagging of candidate interactors

  • Crosslinking Mass Spectrometry (XL-MS):

    • For structural information about interaction interfaces

MethodAdvantagesLimitationsBest For
AP-MSComprehensive, establishedMay lose weak/transient interactionsGlobal interaction mapping
BioID/TurboIDCaptures transient interactionsRequires longer expression timeIdentifying neighborhood proteins
Co-IPSimple, directLess sensitiveValidating specific interactions
XL-MSProvides structural informationComplex analysisDetailed interface mapping

For data analysis, filter against appropriate controls and curate a high-confidence interaction network. Validate key interactions using orthogonal methods like yeast two-hybrid or fluorescence microscopy co-localization. The resulting interaction network can provide insights into SPBC1773.12 function and regulatory pathways .

What is the optimal experimental design for analyzing SPBC1773.12 function in multiple genetic backgrounds?

To comprehensively analyze SPBC1773.12 function across different genetic backgrounds:

  • Strain Selection:

    • Laboratory standard strains (h⁻, h⁺, h⁹⁰)

    • Natural isolates with genetic diversity

    • Strains with defined mutations in related pathways

  • Genetic Modification Approach:

    • Generate consistent gene deletions in all backgrounds

    • Create identical tagged versions across strains

    • Consider CRISPR-Cas9 for precise editing

  • Phenotypic Analysis Matrix:

    • Growth conditions (temperature, media, stressors)

    • Cell morphology and cell cycle progression

    • Specific pathway readouts

  • Data Collection and Analysis:

    • Use high-throughput methods where possible

    • Develop quantitative phenotype scores

    • Apply appropriate statistical tests for strain comparisons

For example, if investigating a potential role in amino acid metabolism regulation, test growth in media with different amino acid compositions across all strains, similar to experiments that revealed the roles of Trm7 and related proteins in S. pombe . Include genetic interactions with known regulators of amino acid metabolism to build a comprehensive functional network.

How can RNA-seq be used to identify genes regulated by SPBC1773.12?

A comprehensive RNA-seq approach to identify SPBC1773.12 targets:

  • Experimental Design:

    • Compare wild-type vs. SPBC1773.12Δ strains

    • Include SPBC1773.12 overexpression strain

    • Test multiple conditions (standard growth, stress conditions)

    • Include appropriate biological replicates (minimum 3)

  • RNA Extraction and Library Preparation:

    • Extract total RNA from mid-log phase cultures using glass bead disruption

    • Assess RNA quality (RIN > 8)

    • Deplete rRNA or isolate mRNA

    • Prepare stranded libraries for directional sequencing

  • Sequencing Parameters:

    • 30-50 million paired-end reads per sample

    • Read length ≥ 75bp for improved mapping

  • Data Analysis Pipeline:

    • Quality control and trimming

    • Mapping to S. pombe genome

    • Quantification at gene and transcript level

    • Differential expression analysis using DESeq2 or similar

    • Pathway and GO term enrichment analysis

  • Validation:

    • Confirm key targets by RT-qPCR

    • Test direct regulation using ChIP-qPCR

    • Analyze promoter elements of regulated genes

Based on studies of transcriptional regulators in S. pombe, changes in expression may be condition-specific. For instance, the GAAC pathway shows significant upregulation of specific genes (like lys4+ and aro8+) under amino acid starvation . Therefore, testing multiple growth conditions is crucial to capture the full regulatory network.

What approaches can resolve conflicting data about SPBC1773.12 function?

When facing contradictory results about SPBC1773.12 function:

  • Systematic Validation Strategy:

    • Recreate strains and repeat experiments independently

    • Use multiple methodological approaches for key findings

    • Ensure genetic background consistency across studies

    • Test across various environmental conditions

  • Genetic Approach to Resolve Conflicts:

    • Generate point mutations rather than complete deletions

    • Create separation-of-function alleles

    • Use auxin-inducible degron (AID) for temporal control

    • Employ complementation with orthologs from related species

  • Integrative Data Analysis:

    • Combine transcriptomics, proteomics, and genetic data

    • Look for consensus across different data types

    • Develop predictive models to explain seemingly contradictory results

  • Specific Experimental Resolutions:

    • For localization conflicts: Use multiple tagging strategies and fixation methods

    • For functional conflicts: Test in defined genetic backgrounds

    • For phenotypic contradictions: Carefully control for suppressor mutations

For example, in studies of tRNA modification proteins in S. pombe, apparent contradictions in phenotypes were resolved by analyzing suppressors through whole-genome sequencing, revealing mutations that masked the original phenotype . Similarly, if conflicting growth phenotypes are observed for SPBC1773.12Δ strains, whole-genome sequencing of the different strains might reveal suppressor mutations explaining the discrepancies.

What are the best methods for purifying recombinant SPBC1773.12 for biochemical studies?

For optimal purification of recombinant SPBC1773.12:

  • Expression Systems Options:

    • E. coli (BL21(DE3) or Rosetta for rare codons)

    • S. pombe native expression

    • S. cerevisiae expression

    • Insect cell/baculovirus system for complex proteins

  • Purification Tags and Strategies:

    • His6 tag for IMAC purification

    • GST tag for affinity purification and solubility

    • MBP tag for improved solubility

    • SUMO or TEV cleavable tags for tag removal

  • Optimization Parameters:

    • Buffer composition (pH, salt, reducing agents)

    • Detergents for membrane association

    • Co-factors or binding partners for stability

    • Temperature and induction conditions

  • Quality Control Methods:

    • SDS-PAGE for purity assessment

    • Mass spectrometry for identity confirmation

    • Size exclusion chromatography for oligomeric state

    • Thermal shift assays for stability optimization

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, simpleLimited PTMsInitial biochemical studies
S. pombeNative modificationsLower yieldAuthentic protein studies
S. cerevisiaeGood PTMs, higher yieldSome PTM differencesStructural studies
Insect cellsMammalian-like PTMsComplex, expensiveComplex protein assembly

For transcription factors like SPBC1773.12, co-expression with DNA binding elements or protein partners may improve stability and solubility. If the protein proves difficult to purify, consider expressing functional domains separately rather than the full-length protein .

How can CRISPR-Cas9 be optimized for studying SPBC1773.12 in S. pombe?

Optimizing CRISPR-Cas9 for studying SPBC1773.12 in S. pombe:

  • Guide RNA Design:

    • Select highly specific target sites with minimal off-targets

    • Optimize for S. pombe codon usage

    • Validate efficiency computationally before testing

    • Target functional domains for domain-specific studies

  • Delivery Methods:

    • Plasmid-based expression

    • RNP complex transformation

    • Integrate Cas9 into genomic safe harbors for stable expression

  • Editing Strategies:

    • Gene knockout: Design guides near start codon

    • Point mutations: Provide repair templates with desired mutations

    • Tagging: Include homology arms with tag sequence

    • Regulatable expression: Insert controllable promoters

  • Verification Methods:

    • PCR and sequencing to confirm edits

    • Whole-genome sequencing to check for off-targets

    • RNA-seq to confirm expression changes

    • Protein analysis to verify modified protein

While traditional homologous recombination has been the standard in S. pombe, CRISPR-Cas9 offers advantages for creating precise mutations or multiple simultaneous edits. For studying transcriptional regulators like SPBC1773.12, CRISPR enables creation of specific domain mutations to dissect DNA binding, transactivation, or protein interaction functions separately .

What bioinformatic approaches can predict SPBC1773.12 binding motifs and target genes?

For computational prediction of SPBC1773.12 binding sites and targets:

  • Sequence-Based Motif Prediction:

    • Analyze DNA-binding domains for familiar motif classes

    • Use tools like MEME, HOMER, or JASPAR for de novo motif discovery

    • Compare with known transcription factor binding sites

  • Structural Prediction Approaches:

    • Predict 3D structure using AlphaFold or similar tools

    • Perform molecular docking with DNA sequences

    • Identify potential DNA-contacting residues

  • Comparative Genomics Methods:

    • Analyze orthologous proteins in related species

    • Look for conserved upstream regions in potential target genes

    • Perform phylogenetic footprinting to identify conserved motifs

  • Network-Based Predictions:

    • Integrate expression data and protein interaction networks

    • Use machine learning to predict regulatory relationships

    • Correlate with chromatin accessibility data (ATAC-seq)

  • Validation Strategy:

    • Test predicted motifs using in vitro assays (EMSA)

    • Validate in vivo with reporter assays

    • Confirm with ChIP-seq or CUT&RUN

If SPBC1773.12 is involved in amino acid metabolism regulation like the nearby aro8+ gene, analyzing promoter regions of genes in related pathways might reveal common motifs. Integration with expression data under various stress conditions, particularly amino acid starvation, could help refine predictions of regulatory targets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.