Recombinant Schizosaccharomyces pombe Uncharacterized transcriptional regulatory protein C417.09c (SPCC417.09c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
It is advisable to briefly centrifuge the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
SPCC417.09c; Uncharacterized transcriptional regulatory protein C417.09c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-767
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC417.09c
Target Protein Sequence
MHARMQPHEDRSRSGMSRSEAMELEDQLEEEERGGNVVVGSSSANANASTAETGKKSAGG SKPKRRRGERIPPSKRIRKAIAYVNKYASGCFGRVERRLVCTRSISRHSNQKLLDFCVEC KKHKIKCVGNFPCGRCLKKGLECVIETPPRLLMNKDEISLNLQRLSHMETILSKLMPSMS LDLPSLEAKIAELSESLQTYPDKVLTDIELGSYQQVTLNETQTYYEDAGSNESFVARVHE IICQGREFQVQHKLTNKGNKTFEDILDPADNTVASLIHALPPKDITFYLLMTFWQFSSDN NHFYYNTKLFAAKVHHLFDDPTSFQSKDGGFVCMLLLSMAMGSLFSYIRHPEFLSDENHD RWTYPGSQFYQNAKLLFPKVISESSLETVQSFFLAGMYLSPTLAHEVVYMYFGIAMRAAV ANGMHKKSANAQFSGDVAELRKRLFWSVYCMERKIGISLGRPESLVRSEIDIHFPEYRES LDSQNFIASFRTFTLAIKISLLTNKVYDMWYSSLHGKANLKAATIKEIVNEIEAWRQQLS PDLEIQNIGPDSRSYRGIVHLHLAYHIVRIAMGRPFLLHRLRERTMNSKTDEGARLLTDK LISYCYSSALHIVDLLVLLRMHKFLSVYSFMDYHSCHAASFIILVHLLINPSEQTIEQLN TAIDILNFVTDRFPLLKGSTDVITNLRAFAEQSEVYQSRLNATEPAYSTQVPFFPRDADY HNQINLQNLWNDENINASLEALFNDAKGFGFLLPADNFIFPSDDGDM
Uniprot No.

Target Background

Database Links
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of the uncharacterized transcriptional regulatory protein SPCC417.09c in S. pombe?

SPCC417.09c is predicted to function as a transcriptional regulator based on sequence homology analysis. Although not specifically characterized in the available search results, similar transcriptional regulators in S. pombe, such as SPBC21B10.13c (which contains a homeobox domain) and SPBC30B4.04c (with an ARID/BRIGHT DNA binding domain), are involved in transcriptional regulation . The protein likely contributes to gene expression control through DNA binding and interaction with chromatin remodeling complexes. For initial characterization, researchers should employ bioinformatics approaches to identify conserved domains and potential DNA binding motifs.

How can I express recombinant SPCC417.09c protein in S. pombe for functional studies?

For successful expression of recombinant SPCC417.09c in S. pombe, several inducible expression systems are available:

  • The urg1 promoter system allows rapid induction within 30 minutes, similar to the S. cerevisiae GAL induction system . This system was optimized to provide faster gene expression control compared to traditional methods.

  • The traditional nmt1 promoter system, which is repressed by thiamine. While effective, this system requires 14-20 hours for full induction following thiamine removal .

Expression SystemInduction TimeInducerExpression LevelNotes
urg1 promoter~30 minutesUracilModerate to highRapid response, ideal for time-sensitive experiments
nmt1 promoter14-20 hoursThiamine removalHighTraditional system with strong expression
Newer systemsVariesVariousVariesSeveral newer systems have been engineered recently

For optimal results, clone the SPCC417.09c coding sequence into appropriate vectors containing these promoters, with tags for detection and purification if needed.

What assays can I use to study the DNA binding specificity of SPCC417.09c?

To characterize the DNA binding properties of SPCC417.09c, implement a multi-faceted approach:

  • Chromatin Immunoprecipitation (ChIP): Express tagged SPCC417.09c in S. pombe and perform ChIP followed by sequencing (ChIP-seq) to identify genomic binding sites. This approach has been successfully used for other S. pombe transcription factors like Pap1, which is involved in oxidative stress response .

  • Electrophoretic Mobility Shift Assay (EMSA): Use purified recombinant SPCC417.09c protein to test binding to candidate DNA sequences identified from ChIP-seq or predicted based on homology with other transcription factors.

  • Yeast One-Hybrid Assay: Adapt this technique to identify DNA sequences that interact with SPCC417.09c by screening a library of potential binding sites.

When analyzing results, consider the context of binding sites relative to genes with altered expression in response to SPCC417.09c perturbation, which will provide insight into its regulatory network.

How can I create a knockout or mutation of SPCC417.09c to study its function?

For genetic manipulation of SPCC417.09c in S. pombe, several approaches can be employed:

  • Homologous Recombination: Design constructs with homology regions flanking the SPCC417.09c gene. This is the traditional approach for gene deletion in S. pombe and has been used successfully for characterizing numerous transcriptional regulators .

  • CRISPR-Cas9 System: While more recent, CRISPR-Cas9 has been adapted for S. pombe and offers precision in generating both null mutations and specific point mutations. This allows for the study of domain-specific functions.

  • Conditional Expression Systems: If SPCC417.09c is essential, use the urg1 promoter system for conditional expression studies, which allows rapid transcriptional induction within 30 minutes .

For phenotypic analysis, examine growth under various stress conditions similar to those used in studies of other transcriptional regulators like Pap1 (oxidative stress) or Cuf1 (metal stress response) .

What cellular pathways might SPCC417.09c be involved in based on known transcriptional regulators in S. pombe?

Based on characterized transcriptional regulators in S. pombe, SPCC417.09c may participate in several key cellular pathways:

  • Stress Response Pathways: Similar to Pap1, which functions in oxidative stress response, or Cuf1, which regulates copper and iron responses . Examine SPCC417.09c expression and activity under various stress conditions.

  • Chromatin Remodeling: Many transcriptional regulators in S. pombe interact with chromatin remodeling complexes. For instance, Cph1 is a component of the Clr6p-HDAC complex required for histone H3 K9 deacetylation . Investigate potential interactions between SPCC417.09c and known chromatin remodeling factors.

  • Cell Cycle Regulation: Transcription factors like Mcs1 function in cell cycle control through the DSC1/MBF transcription factor complex . Analyze cell cycle progression in SPCC417.09c mutants.

PathwayRelated S. pombe RegulatorsPotential Assays for SPCC417.09c Involvement
Stress ResponsePap1, Spc1, Cuf1Growth under oxidative, metal, osmotic stress
Chromatin RemodelingCph1, Sin3, Gcn5Histone modification ChIP, co-IP with remodeling factors
Cell CycleMcs1Flow cytometry, synchronized cultures
Metabolic RegulationPhp5Growth on different carbon sources

How can I determine if SPCC417.09c interacts with other transcription factors or chromatin remodeling complexes?

To identify protein-protein interactions involving SPCC417.09c:

  • Co-Immunoprecipitation (Co-IP): Express tagged SPCC417.09c in S. pombe and perform Co-IP followed by mass spectrometry to identify interaction partners. Focus on known transcriptional complexes such as SAGA (containing Gcn5, Sgf29, and Kap1) or the INO80 complex (containing SPAC664.02c and SPAC6B12.05c) .

  • Yeast Two-Hybrid Screening: Use SPCC417.09c as bait to screen for interacting proteins, particularly focusing on other transcription factors and chromatin modifiers.

  • Bimolecular Fluorescence Complementation (BiFC): For validating specific interactions in vivo, express fragments of a fluorescent protein fused to SPCC417.09c and candidate interactors.

Interactions should be validated using multiple techniques and functional assays to confirm biological relevance.

How can I perform genome-wide analysis to identify all genes regulated by SPCC417.09c?

For comprehensive identification of SPCC417.09c target genes, implement a multi-omics approach:

  • RNA-Seq Analysis: Compare transcriptome profiles between wild-type and SPCC417.09c deletion or overexpression strains. This approach has been successfully used to identify genes regulated by various transcription factors in S. pombe .

  • ChIP-Seq: Map genome-wide binding sites of SPCC417.09c to identify direct targets. Integration with RNA-Seq data will distinguish direct from indirect regulation.

  • ATAC-Seq: Assess chromatin accessibility changes in response to SPCC417.09c perturbation to understand its impact on chromatin structure.

  • Genome-Wide Synthetic Genetic Array: Screen for genetic interactions between SPCC417.09c and other genes to identify functional relationships, similar to approaches used in cadmium tolerance screens .

Data integration workflow:

  • Identify differentially expressed genes from RNA-Seq

  • Map SPCC417.09c binding sites from ChIP-Seq

  • Correlate binding with expression changes

  • Validate key targets with reporter assays

What approaches can resolve contradictory data regarding SPCC417.09c function?

When confronting contradictory experimental results regarding SPCC417.09c function:

  • Strain Background Verification: Confirm genetic background of all strains used, as background mutations can influence phenotypes. Sequence verification of the SPCC417.09c locus and surrounding regions is essential.

  • Condition-Specific Effects: Test function under various environmental conditions, as many transcriptional regulators show context-dependent activity. For example, the stress-activated protein kinase pathway in S. pombe responds differently depending on stress type .

  • Functional Redundancy Assessment: Create double or triple mutants with related transcription factors to uncover redundant functions that may mask phenotypes in single mutants.

  • Dosage-Dependent Analysis: Examine effects across a range of expression levels using the urg1 inducible promoter system, which allows fine-tuning of expression timing and level .

  • Tissue-Specific or Cell Cycle-Specific Analysis: Determine if contradictions arise from differential activity during specific cell cycle phases or under specific physiological states.

How should I analyze ChIP-seq data to identify biologically relevant SPCC417.09c binding sites?

For robust analysis of ChIP-seq data for SPCC417.09c:

  • Peak Calling Optimization: Use multiple peak-calling algorithms (MACS2, GEM, HOMER) and focus on consensus peaks. Consider the expected binding profile based on predicted DNA binding domains in SPCC417.09c.

  • Motif Discovery: Employ tools like MEME, DREME, or HOMER to identify enriched sequence motifs within binding regions. Compare with known motifs of related transcription factors.

  • Genomic Distribution Analysis: Examine the distribution of binding sites relative to genomic features (promoters, enhancers, gene bodies). Many S. pombe transcription factors show preferential binding in specific regions.

  • Integration with Expression Data: Correlate binding with gene expression changes in SPCC417.09c mutants to distinguish functional from non-functional binding events.

  • Comparative Analysis: Compare binding patterns under different conditions (stress vs. normal growth) to identify condition-specific regulatory events.

Analysis StepToolsKey Considerations
Quality ControlFastQC, ChIPQCSequencing depth, fragment size distribution
AlignmentBowtie2, BWAS. pombe genome version, repetitive regions
Peak CallingMACS2, HOMERFDR threshold, control normalization
Motif DiscoveryMEME, DREMEMotif width, background model selection
Functional AnalysisGREAT, custom scriptsGene ontology, pathway enrichment

What statistical methods are appropriate for analyzing differential gene expression in SPCC417.09c mutants?

When analyzing differential gene expression in SPCC417.09c experiments:

  • Experimental Design Considerations:

    • Include at least 3-4 biological replicates per condition

    • Control for batch effects through experimental design and analysis

    • Include appropriate controls (empty vector, wild-type strain)

  • Normalization Approaches:

    • For RNA-seq: TMM (edgeR), DESeq2 normalization, or quantile normalization

    • Account for differences in library size and composition

  • Statistical Testing:

    • For RNA-seq: Negative binomial models (DESeq2, edgeR)

    • Control for multiple testing using Benjamini-Hochberg FDR

    • Consider gene length and GC content biases

  • Biological Significance Assessment:

    • Implement fold-change thresholds alongside statistical significance

    • Prioritize consistently changed genes across replicates

    • Validate key targets using RT-qPCR

  • Pathway and Network Analysis:

    • Conduct gene set enrichment analysis using Gene Ontology

    • Identify potential co-regulated gene modules

    • Compare with datasets from related transcription factors

How can I use recombination assays to study the potential role of SPCC417.09c in DNA repair or genome stability?

S. pombe offers sophisticated recombination assays that can be adapted to study SPCC417.09c's potential role in genome stability:

  • Intrachromosomal Recombination Assay: Utilize the system described by Watson et al., which places two overlapping S. cerevisiae LEU2 fragments around a functional his3+ gene, allowing detection of single-strand annealing (SSA) events . Introducing this construct into SPCC417.09c mutant strains can reveal effects on SSA efficiency.

  • Direct Repeat Recombination System: Employ the assay featuring a functional his3+ gene between truncated ura4 alleles with 200bp of overlapping sequence. This system specifically detects deletion events resulting from recombination, not conversion .

  • Double-Strand Break Repair Analysis: Modify existing systems to include inducible endonuclease sites (e.g., I-SceI) near potential SPCC417.09c binding sites to study repair outcomes in response to programmed breaks.

  • Replication Fork Stability Assays: Replication stress can trigger recombination events; examine recombination rates in SPCC417.09c mutants treated with hydroxyurea or other replication stress inducers.

Compare recombination frequencies between wild-type and SPCC417.09c mutant strains under various conditions to determine if this transcription factor influences genome stability mechanisms.

How might SPCC417.09c function in stress response pathways based on other characterized S. pombe transcriptional regulators?

To investigate SPCC417.09c's potential role in stress response:

  • Comparative Analysis with Known Stress Regulators: Draw parallels with characterized stress-responsive transcription factors such as Pap1 (oxidative stress) and Cuf1 (metal stress) . Generate double mutants to identify genetic interactions.

  • Stress Response Assays: Subject SPCC417.09c mutants to various stresses, including:

    • Oxidative stress (H₂O₂, menadione)

    • Metal toxicity (cadmium, copper)

    • DNA damage (UV, MMS, hydroxyurea)

    • Temperature stress

    • Osmotic stress

  • Integration with Stress-Activated Protein Kinase (SAPK) Pathway: Investigate potential connections to the Spc1 MAPK cascade, which includes Wis4 (MAPKKK) and Mcs4 (response regulator) and is central to stress signaling in S. pombe .

  • Transcriptional Profiling Under Stress: Perform RNA-seq on wild-type and SPCC417.09c mutants under various stress conditions to identify stress-specific transcriptional programs potentially regulated by SPCC417.09c.

Stress ConditionKey Pathways in S. pombeAssessment Methods
Oxidative StressPap1-regulated genes, SAPKGrowth on H₂O₂ plates, ROS measurement
Metal StressCuf1-regulated, Sulfate assimilationCadmium/copper tolerance assays
DNA DamageRecombination proteins, Cell cycle checkpointsSurvival after UV/MMS, Rad52 foci
Nutrient StressCCAAT-binding factors (Php5)Growth on limited media

What emerging technologies could enhance our understanding of SPCC417.09c function in S. pombe?

Several cutting-edge technologies could significantly advance our understanding of SPCC417.09c:

  • CUT&RUN and CUT&Tag: These techniques provide higher resolution mapping of transcription factor binding sites compared to traditional ChIP-seq, with lower background and sample requirements.

  • Single-Cell RNA-Seq: Apply to heterogeneous populations of S. pombe cells expressing different levels of SPCC417.09c to detect cell-to-cell variability in transcriptional responses.

  • Hi-C and Micro-C: These chromosome conformation capture techniques could reveal how SPCC417.09c influences 3D genome organization and long-range chromatin interactions.

  • CRISPR Activation/Interference: Adapt these technologies for S. pombe to modulate SPCC417.09c activity at specific loci without altering the protein's global levels.

  • Proteomic Approaches: Proximity-dependent biotin identification (BioID) or APEX2 labeling to identify proteins that interact with SPCC417.09c in their native cellular context.

  • In Vitro Transcription Systems: Develop S. pombe-specific reconstituted transcription systems to directly test SPCC417.09c's effect on transcription mechanics.

How can computational approaches predict the genome-wide regulatory network of SPCC417.09c?

Computational methods to predict SPCC417.09c's regulatory network include:

  • Integrative Network Modeling: Combine multiple data types (ChIP-seq, RNA-seq, protein-protein interactions) to construct comprehensive regulatory networks, similar to approaches used for well-characterized S. pombe transcription factors.

  • Comparative Genomics: Identify conserved binding sites and regulated genes across related Schizosaccharomyces species to prioritize functionally important targets.

  • Machine Learning Approaches: Train models on known transcription factor binding sites to predict SPCC417.09c binding preferences and potential target genes.

  • Motif-Based Scanning: Use discovered binding motifs to scan the S. pombe genome for potential regulatory sites, incorporating chromatin accessibility data to refine predictions.

  • Bayesian Network Inference: Apply probabilistic frameworks to infer causal relationships between SPCC417.09c and other genes from time-series expression data.

These computational predictions should generate testable hypotheses that can be validated experimentally using the techniques described throughout this FAQ.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.