Recombinant Schizosaccharomyces pombe Uncharacterized transcriptional regulatory protein PB1A11.04c (SPAPB1A11.04c)

Shipped with Ice Packs
In Stock

Description

General Information

SPAPB1A11.04c, also known as mca1, is a protein-coding gene in Schizosaccharomyces pombe that functions as a DNA-binding transcription factor . It is categorized as a transcriptional regulator with a zinc finger protein domain, specifically a zf-fungal Zn(2)-Cys(6) binuclear cluster domain, and shows similarity to Sp SPAC1327.01C .

Gene and Protein Features

  • Gene Name: SPAPB1A11.04c

  • Gene ID: 49/D05

  • ORF Length (unspliced): 2094 bp

  • Amino Acid Length: 697 residues

  • Molecular Weight: 79.2 kDa

  • Isoelectric Point: 7.9

  • Intron Number: 0

  • Sequence Status: Finished

Experimental Data

CategoryInformation
Localization (YFP)No apparent signal
NLS PositionNone
NES MotifLTNITCLLLL/LRMVDSLDL/LTYLLRNVLDL
Effect of LMB on LocalizationNot determined

Role in Flocculation

Research has shown that Schizosaccharomyces pombe has a complex network of transcription factors regulating flocculation, a process where cells aggregate . SPAPB1A11.04c may play a role in this network .

Involvement in Stress Response

The Sty1 MAPK pathway in Schizosaccharomyces pombe is crucial for the cellular response to various stresses, including hydrogen peroxide (H2O2) exposure . SPAPB1A11.04c, as a transcription factor, might be involved in this stress response, potentially regulating genes activated under such conditions .

Interaction with Cullin-4 Ubiquitin Ligase

SPAPB1A11.04c may interact with the Cullin-4 ubiquitin ligase complex, specifically through Cdt2, which is a regulatory subunit of the Pcu4–Ddb1–CSN ubiquitin ligase in Schizosaccharomyces pombe . This interaction could be relevant in the context of DNA damage response and cell cycle control .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SPAPB1A11.04c; Uncharacterized transcriptional regulatory protein PB1A11.04c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-697
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAPB1A11.04c
Target Protein Sequence
MIAAVEKDAVPRKRRVISQVSQACIRCRQKKIKCSGEKPSCQACSNNKVECIWPDRPNMR GKKPSSAARTLSPLTGIVQPYLGSHPFSPTILSPSSPNMDFTYSINSFGDYQKQLRLPTS RKLLQLWDIFLKTSYTELFGIFNKAQITSQIASDTAPPVLVLCICAHAARFSQEEVNRFK SSTAASDYYANQAFSLLPCRFQDISLTNITCLLLLCLIELGSCRGAKAWLLLGMALRMVD SLDLGNEINDNPLTMGSNTVSWTEAEQKRRVYWACFFVERLLSTGYMAPSKLRSLSLSLQ KTSIQLPCPEPNFLFNQPILTELFDGSLPENTQSDTTSMAPYQRSLQLEFMTGSLIRLSN LWSEISRWALCGGYTKDITPPWLNQSQFHRSFELLKAWHENLPPRAVWSYTNYSAYSSPG ESAGACYTFMHLLYHTTLTYLLRNVLDLFPEKSRQKSKLFSSVSQRFGQQPPTVWMDMIL DQVITSADFITKLSKDPLNYIMSPFVGFSILTAATIHMLLKFCVVNIDQNYISSSRLVHV DHQILQDRSKYWKINQAMLVTLQRLYNFYRFQYLEEQSLYNFKIPGFPLCILEYGIVEDQ SMKSNPDLNSFSKELFSRGTNELLNNGDDTQSGNSTPAMGVSEIRTDTILDEEVPVDPLI TSILDDGRWWEEMFGSERKAGFKETVFEDMNGRSIRL
Uniprot No.

Target Background

Database Links
Subcellular Location
Nucleus membrane; Single-pass membrane protein.

Q&A

What is SPAPB1A11.04c and what are its key structural features?

SPAPB1A11.04c (Mca1) is an uncharacterized transcriptional regulatory protein in Schizosaccharomyces pombe containing a fungal Zn(2)-Cys(6) binuclear cluster domain. The protein contains three key structural components: a DNA-binding domain, a middle homology regulatory region, and a transactivation domain . The full-length protein consists of 697 amino acids with a molecular weight of 79.2 kDa and an isoelectric point of 7.9 .

Analysis of its amino acid sequence reveals multiple AT-hook motifs that are essential for its DNA-binding function, similar to the structure observed in other transcription factors with regulatory roles in S. pombe . The presence of specific motifs (NES motif: LTNITCLLLL/LRMVDSLDL/LTYLLRNVLDL) suggests potential nucleocytoplasmic shuttling capabilities, although localization studies using YFP fusion proteins have shown no apparent specific localization signal .

How is SPAPB1A11.04c classified among S. pombe transcription factors?

SPAPB1A11.04c belongs to the fungal Zn(2)-Cys(6) binuclear cluster domain family of transcription factors . In comparative analyses of regulatory transcription factors between Schizosaccharomyces pombe and budding yeast, it falls within a specific subset of zinc finger proteins that play key roles in phase-specific gene regulation during the cell cycle .

Within the broader classification of S. pombe transcriptional regulatory networks, SPAPB1A11.04c/Mca1 has been identified as having highly significant periodic activity, placing it among the 36 transcription factors with strong temporal regulation in fission yeast . Phylogenetic analysis suggests it shares functional domains with SPAC1327.01C, another zinc finger protein in S. pombe .

What are the recommended methods for recombinant expression of SPAPB1A11.04c?

For recombinant expression of SPAPB1A11.04c, several validated approaches have proven successful based on published literature:

  • Baculovirus expression system: This has been effectively used for the expression of S. pombe transcription factors with complex structural domains. The protein can be expressed with various tags (determined during the production process) to facilitate purification .

  • PCR amplification and cloning strategy: The full-length gene can be isolated from S. pombe strain FY435 genomic DNA using primers designed to generate appropriate restriction sites (e.g., XmaI and SacII) at the termini of the open reading frame. The PCR product can then be digested and cloned into an appropriate expression vector .

  • Fusion protein approach: For functional studies, SPAPB1A11.04c can be fused with reporter tags such as TAP or fluorescent markers (Cherry) by inserting the tag coding sequence immediately before the stop codon .

Storage of the purified protein requires 50% glycerol in Tris-based buffer, with recommended storage at -20°C or -80°C for extended periods. Repeated freeze-thaw cycles should be avoided; working aliquots can be stored at 4°C for up to one week .

What is the role of SPAPB1A11.04c (Mca1) in copper homeostasis during meiosis?

SPAPB1A11.04c, renamed Mca1 (meiosis copper starvation-dependent activator), plays a crucial role in regulating copper homeostasis during meiosis in S. pombe . Research has demonstrated that Mca1 is required for the full activation of the mfc1+ gene, which encodes a meiosis-specific copper transporter, under conditions of copper starvation .

Interestingly, while mfc1+ expression is tightly regulated by copper availability, the expression pattern of Mca1 itself shows only slight variations during meiotic progression, with marginally increased levels observed after 5-7 hours of meiotic induction . This suggests that post-translational modifications or interactions with other factors likely modulate Mca1 activity in response to copper status.

How does SPAPB1A11.04c participate in transcriptional regulatory networks?

SPAPB1A11.04c functions within complex transcriptional regulatory networks (TRNs) in S. pombe, particularly in phase-specific gene regulation during the cell cycle . Network analysis has identified SPAPB1A11.04c as one of the 36 transcription factors with strongly periodic activity patterns, regulating approximately 531 target genes during different phases of the cell cycle .

The network position of SPAPB1A11.04c was elucidated through the reconstruction of a global gene regulatory network using multiple algorithmic strategies:

  • Estimates of time period and phase angles from a non-linear model

  • Computation of phase-specific time-lagged correlations between TF-gene pairs

  • Partitioning of genes into co-expressed and co-regulated clusters

Statistical analysis of SPAPB1A11.04c's activity revealed a p-value of 1.35E-05 for periodicity, confirming its significant role in temporal gene regulation . Within the broader network, SPAPB1A11.04c appears to primarily regulate modules in the M and G1 phases of the cell cycle, suggesting its involvement in controlling the expression of genes required for cell division and subsequent growth .

How is the DNA-binding specificity of SPAPB1A11.04c determined?

The DNA-binding specificity of SPAPB1A11.04c is primarily determined by its N-terminal domain containing multiple AT-hook motifs, which recognize and bind to AT-rich sequences in target promoters . This domain architecture is reminiscent of the high mobility group A (HMGA) family of proteins, which possess multiple AT-hook motifs that interact with the minor groove of AT-rich DNA sequences .

Research on similar proteins suggests that a single AT-hook motif typically binds to the minor groove of an AT-rich sequence between four and six base pairs in length, with optimal binding centered on AA(T/A)T sequences . The presence of multiple AT-hook motifs in SPAPB1A11.04c likely enables it to interact with several sites in a DNA substrate simultaneously, increasing binding strength and potentially affecting DNA conformation.

Experimental approaches to determine binding specificity include:

  • Nitrocellulose filter binding assays: Used to measure the affinity of SPAPB1A11.04c for different DNA fragments

  • DNA-binding competition assays: To identify specific sequences that compete for binding

  • DNase I footprinting studies: To map the precise sequences protected by SPAPB1A11.04c binding

These methods have revealed that similar proteins with AT-hook domains preferentially interact with several AT-rich sequence regions distributed throughout target promoters, rather than recognizing a single specific consensus sequence .

What are the recommended strategies for studying SPAPB1A11.04c DNA-binding properties?

To comprehensively characterize the DNA-binding properties of SPAPB1A11.04c, a multi-faceted experimental approach is recommended:

  • Protein purification and complex reconstitution: Express and purify SPAPB1A11.04c using the baculovirus expression system, which has been successfully employed for similar S. pombe transcription factors . For comparative studies, prepare both wild-type protein and versions with N-terminal deletions lacking the AT-hook motifs.

  • Nitrocellulose filter binding assays: These assays provide quantitative measurements of binding affinity between the purified protein and target DNA sequences. They can be conducted with both full-length target promoters and smaller fragments to identify specific binding regions .

  • DNA-binding competition assays: These assays help identify the most important sequences for binding by competing unlabeled DNA fragments against labeled target sequences .

  • DNase I footprinting: This technique precisely maps the protected sequences where SPAPB1A11.04c binds to DNA. When performed with full-length targets, it provides a comprehensive view of all binding sites within a promoter region .

For analyzing AT-rich binding preferences specifically, researchers should prepare DNA substrates with varying AT content and distribution patterns to determine the optimal binding sequences. Similar studies with related proteins have shown that factors with AT-hook domains interact primarily with sequences in the minor groove of AT-rich DNA regions, recognizing these structures rather than specific nucleotide sequences .

How can researchers effectively disrupt or modify SPAPB1A11.04c function for phenotypic studies?

Several validated approaches exist for disrupting or modifying SPAPB1A11.04c function to study its phenotypic effects:

  • Gene deletion (knockout approach): Create SPAPB1A11.04cΔ strains through insertional inactivation or complete gene replacement. This approach has successfully demonstrated the role of SPAPB1A11.04c in regulating mfc1+ expression under copper starvation conditions .

  • Domain-specific mutations: Generate strains expressing SPAPB1A11.04c with specific domains mutated or deleted. For example, N-terminal deletions that remove the AT-hook motifs can disrupt DNA-binding while preserving other protein functions .

  • Fusion protein strategy: Create functional fusion proteins by inserting reporter tags (TAP, Cherry) immediately before the stop codon of SPAPB1A11.04c. This approach allows for both visualization of protein localization and affinity purification for interactome studies .

  • Promoter replacement: Replace the native promoter with controllable promoters such as the nmt1 promoter (thiamine-repressible) or the urg1 promoter (rapidly inducible within 30 minutes) , allowing for temporal control of SPAPB1A11.04c expression.

For phenotypic analysis, researchers should examine copper homeostasis during meiosis, as SPAPB1A11.04c-deficient cells show significant defects in mfc1+ expression under copper starvation conditions . Additional phenotypes may include alterations in cell cycle progression, particularly during M and G1 phases where SPAPB1A11.04c appears to regulate specific gene modules .

What experimental design is optimal for identifying SPAPB1A11.04c target genes?

An optimal experimental design for identifying SPAPB1A11.04c target genes should incorporate multiple complementary approaches:

  • ChIP-seq or ChIP-exo analysis: Chromatin immunoprecipitation followed by sequencing provides genome-wide identification of SPAPB1A11.04c binding sites. ChIP-exo offers higher resolution by precisely mapping the boundaries of protein-DNA interactions . For this approach:

    • Express SPAPB1A11.04c with an appropriate tag (TAP or HA)

    • Perform crosslinking under conditions where SPAPB1A11.04c is active

    • Immunoprecipitate bound DNA and prepare libraries for sequencing

    • Analyze resulting data to identify binding peaks genome-wide

  • Transcriptome analysis: Compare gene expression profiles between wild-type and SPAPB1A11.04c-deficient strains under relevant conditions:

    • For studies related to copper homeostasis, include copper-replete and copper-starved conditions during meiosis

    • For cell cycle studies, synchronize cells and collect samples at different cell cycle phases

    • Use RNA-seq or microarray analysis to identify differentially expressed genes

  • Integration of binding and expression data: Combine ChIP-seq binding data with transcriptome data to distinguish direct from indirect targets. True direct targets should show both SPAPB1A11.04c binding in ChIP-seq and expression changes in SPAPB1A11.04c-deficient cells .

  • Motif analysis: Analyze sequences from ChIP-seq peaks to identify enriched DNA motifs that might represent SPAPB1A11.04c binding sites. Given the protein's AT-hook domains, focus particularly on AT-rich sequence patterns .

  • Validation of individual targets: Confirm direct regulation through:

    • Reporter gene assays using promoters of candidate target genes

    • Site-directed mutagenesis of putative binding sites

    • In vitro binding assays with purified components

This integrated approach has been successfully employed for transcription factor target identification in S. pombe and other organisms .

How can systems biology approaches be applied to understand SPAPB1A11.04c's role in transcriptional networks?

Systems biology approaches offer powerful frameworks for understanding SPAPB1A11.04c's role within broader transcriptional networks:

  • Network Component Analysis (NCA): This computational approach can infer transcription factor activities (TFAs) from gene expression data and known regulatory relationships. Applied to SPAPB1A11.04c, NCA can reveal its temporal activity patterns across different conditions or cell cycle phases . Previous studies have used this method to identify 36 TFs with strongly periodic activities in S. pombe, including SPAPB1A11.04c .

  • Model-driven experimental design workflow: Implementing a genome-scale model-driven workflow can help design experimental conditions that optimally activate SPAPB1A11.04c . This approach involves:

    • Building a preliminary regulatory network model

    • Simulating transcription factor activities under various conditions

    • Identifying conditions predicted to maximize SPAPB1A11.04c activity

    • Experimentally validating these conditions

    • Refining the model based on experimental results

  • Bayesian network inference: Co-clustering expression data using enhanced Bayesian algorithms can identify regulatory modules controlled by SPAPB1A11.04c. Previous studies have used this approach to obtain 31 clusters of co-regulated genes from different phases of the cell cycle in S. pombe .

  • Integration of multi-omics data: Combine transcriptomics, proteomics, and metabolomics data to understand how SPAPB1A11.04c-mediated transcriptional changes affect cellular physiology. This is particularly relevant for studying its role in copper homeostasis during meiosis, where metabolic adaptations to copper limitation may involve multiple regulatory layers .

  • Comparative network analysis: Compare SPAPB1A11.04c-centered regulatory networks with those of homologous transcription factors in related species to identify conserved and divergent features .

These systems approaches can reveal emergent properties of SPAPB1A11.04c-regulated networks that would not be apparent from studying individual genes or pathways in isolation.

What are the challenges in distinguishing SPAPB1A11.04c-specific effects from those of related transcription factors?

Distinguishing SPAPB1A11.04c-specific effects from those of related transcription factors presents several significant challenges:

  • Functional redundancy: S. pombe contains multiple transcription factors with fungal Zn(2)-Cys(6) binuclear cluster domains that may have overlapping functions. Studies have identified at least four related zinc binuclear cluster transcription factors (SPAPB1A11.04c, SPCC777.02, SPAPB24D3.01, and SPAC11D3.07c) that could potentially regulate similar target genes . Experimental strategies to address this include:

    • Creating and analyzing single and multiple knockout combinations

    • Performing conditional depletion of individual factors

    • Using chimeric proteins with swapped domains to test specificity

  • Similar binding preferences: SPAPB1A11.04c's AT-hook domains target AT-rich sequences, which are also recognized by other DNA-binding proteins. To differentiate binding specificity:

    • Perform competitive ChIP experiments

    • Conduct detailed motif analysis of binding sites

    • Use high-resolution binding assays like ChIP-exo that can detect subtle differences in binding locations

  • Condition-specific activity: SPAPB1A11.04c may share targets with other factors but operate under specific conditions (e.g., copper starvation during meiosis) . Experimental design should include:

    • Precisely controlled environmental conditions

    • Temporal analysis across different physiological states

    • Combinatorial perturbation of environmental factors

  • Complex regulatory interactions: SPAPB1A11.04c may function in complexes with other regulatory proteins or be subject to regulation by other factors. To unravel these interactions:

    • Perform protein-protein interaction studies (co-IP, BioID)

    • Map the upstream regulators of SPAPB1A11.04c

    • Study post-translational modifications that affect activity

  • Technical limitations in detection: Low abundance or condition-specific expression can limit detection of SPAPB1A11.04c-regulated genes. Strategies to overcome this include:

    • Using sensitive methods like RNA-seq with high sequencing depth

    • Enriching for specific cell populations or cell cycle phases

    • Employing single-cell approaches to detect heterogeneous responses

How can structural biology approaches contribute to understanding SPAPB1A11.04c function?

Structural biology approaches can provide critical insights into SPAPB1A11.04c function at the molecular level:

  • Domain structure determination: Using X-ray crystallography or NMR spectroscopy to solve the structures of individual domains:

    • The DNA-binding domain with AT-hook motifs

    • The middle homology regulatory region

    • The transactivation domain

    These structures would reveal the spatial arrangement of key residues involved in DNA recognition and protein-protein interactions.

  • DNA-protein complex structures: Co-crystallization of the DNA-binding domain with target DNA sequences would reveal:

    • The precise mode of interaction with AT-rich sequences

    • The role of specific residues in DNA recognition

    • Potential conformational changes induced by DNA binding

    Similar studies with AT-hook domains in other proteins have shown they bind to the minor groove of AT-rich DNA sequences, causing structural alterations that may be important for transcriptional regulation .

  • Integration with computational approaches: Molecular dynamics simulations can model:

    • The flexibility of AT-hook domains in solution

    • Dynamic interactions with different DNA sequences

    • Conformational changes during binding

  • In situ structural studies: Techniques like cryo-electron microscopy could potentially visualize SPAPB1A11.04c in complex with other transcriptional machinery components at target promoters.

  • Structure-guided functional studies: Once structural information is available, targeted mutations can be designed to:

    • Disrupt specific DNA interactions without affecting protein stability

    • Alter binding specificity through rational design

    • Probe the function of specific protein-protein interaction surfaces

  • Comparative structural analysis: Comparing SPAPB1A11.04c structures with those of related transcription factors could reveal:

    • Conserved structural features important for common functions

    • Unique structural elements that confer specificity

    • Potential evolutionary relationships and functional divergence

Structural insights would complement genomic and biochemical approaches by providing a mechanistic understanding of how SPAPB1A11.04c recognizes its targets and recruits transcriptional machinery.

How should researchers interpret apparent discrepancies in SPAPB1A11.04c binding data?

When interpreting discrepancies in SPAPB1A11.04c binding data, researchers should consider several factors that might explain the observed variations:

  • Experimental conditions affecting binding: SPAPB1A11.04c's binding activity may be highly sensitive to experimental conditions:

    • Buffer composition (particularly salt concentration affecting electrostatic interactions)

    • Temperature and pH variations between experiments

    • Protein concentration differences (particularly important for proteins with multiple binding sites)

  • Technical variations in detection methods: Different methods have inherent biases:

    • ChIP-seq may have lower resolution compared to ChIP-exo

    • DNase I footprinting can miss binding sites if the protein doesn't significantly alter DNA accessibility

    • In vitro binding assays may not recapitulate in vivo conditions

  • Cooperative binding effects: SPAPB1A11.04c contains multiple AT-hook motifs that may exhibit cooperative binding:

    • The presence of multiple AT-rich sequences in close proximity may enhance binding

    • Cooperative effects may be lost when studying isolated DNA fragments

    • Similar proteins with multiple AT-hooks interact with multiple sites simultaneously, affecting binding strength

  • Context-dependent binding: SPAPB1A11.04c binding may depend on:

    • Chromatin structure and nucleosome positioning

    • The presence of cofactors or other regulatory proteins

    • Post-translational modifications affecting binding affinity

  • Biological variability: True biological differences may exist between:

    • Different cell cycle phases

    • Various nutritional or stress conditions

    • Strain background genetic variations

When reconciling discrepant data, researchers should systematically examine these factors and design controlled experiments that can directly test specific hypotheses about the source of variation. Integrating results from multiple approaches (in vitro binding, in vivo ChIP, functional assays) can provide a more robust understanding of SPAPB1A11.04c's binding properties.

What are the best practices for validating potential SPAPB1A11.04c target genes?

Robust validation of potential SPAPB1A11.04c target genes requires a multi-layered approach:

  • Establish direct binding evidence:

    • Perform ChIP-qPCR to confirm binding to specific promoter regions

    • Use multiple antibodies or tagged versions of SPAPB1A11.04c to rule out artifacts

    • Demonstrate binding specificity through competition with unlabeled DNA or with mutated binding sites

  • Demonstrate functional regulation:

    • Show differential expression of candidate genes in SPAPB1A11.04c deletion vs. wild-type strains

    • Perform time-course studies following SPAPB1A11.04c induction/depletion to capture direct effects

    • Use reporter gene assays with wild-type and mutated promoters of target genes

  • Establish binding site functionality:

    • Identify putative binding motifs within ChIP peaks

    • Perform site-directed mutagenesis of these motifs

    • Show loss of SPAPB1A11.04c binding and regulatory effect when motifs are mutated

  • Rule out indirect effects:

    • Use rapid induction systems (like the urg1 promoter) to identify immediate-early responses

    • Perform regulation studies in the presence of protein synthesis inhibitors

    • Demonstrate direct physical interaction through in vitro binding with purified components

  • Establish biological relevance:

    • Show that target gene dysregulation contributes to SPAPB1A11.04c deletion phenotypes

    • Demonstrate consistent regulation under physiologically relevant conditions (e.g., copper starvation for mfc1+)

    • Perform epistasis analysis by creating double mutants of SPAPB1A11.04c and its target genes

  • Apply stringent statistical analysis:

    • Use appropriate multiple testing corrections for genome-wide studies

    • Establish clear significance thresholds for binding and expression changes

    • Employ statistical methods that integrate binding and expression data

By systematically applying these validation approaches, researchers can confidently identify genuine SPAPB1A11.04c target genes and distinguish them from false positives resulting from technical artifacts or indirect effects.

How can researchers distinguish direct transcriptional effects of SPAPB1A11.04c from secondary regulatory cascades?

Distinguishing direct transcriptional effects of SPAPB1A11.04c from secondary regulatory cascades requires careful experimental design and data analysis:

  • Temporal analysis with high resolution:

    • Use rapid and synchronized induction systems, such as the urg1 promoter system that allows induction within 30 minutes

    • Collect samples at multiple early time points (e.g., 5, 15, 30, 60 minutes) post-induction

    • Direct targets typically respond more rapidly than genes regulated through secondary cascades

  • Protein synthesis inhibition:

    • Perform gene expression analysis in the presence of cycloheximide or other protein synthesis inhibitors

    • Genes that still respond to SPAPB1A11.04c activation under these conditions are likely direct targets

    • Secondary targets requiring synthesis of intermediate regulators will not respond

  • Integration of binding and expression data:

    • Calculate the correlation between binding strength (ChIP signal) and expression change magnitude

    • Direct targets often show stronger correlation between binding and expression changes

    • Develop integrated statistical models that combine binding probability with expression change significance

  • Analysis of binding site features:

    • Direct targets are more likely to contain canonical binding motifs in their promoters

    • The presence of AT-rich sequences compatible with AT-hook domain binding supports direct regulation

    • The proximity of binding sites to transcription start sites often correlates with regulatory potential

  • Use of degron or other rapid protein depletion systems:

    • Employ auxin-inducible or temperature-sensitive degron tags to achieve rapid depletion of SPAPB1A11.04c

    • Monitor transcriptional changes immediately following depletion

    • Direct targets typically show more immediate response to transcription factor depletion

  • Network modeling approaches:

    • Develop mathematical models of the regulatory network that include both direct and indirect interactions

    • Test model predictions against experimental data

    • Use perturbation analysis to distinguish direct from indirect effects

  • Single-cell approaches:

    • Employ single-cell RNA-seq to detect heterogeneity in transcriptional responses

    • Direct targets often show more homogeneous responses across the cell population

    • Secondary targets may show greater cell-to-cell variability due to additional regulatory inputs

By systematically applying these approaches, researchers can construct a high-confidence list of direct SPAPB1A11.04c targets distinguished from genes affected through secondary regulatory mechanisms.

What are promising approaches for elucidating the complete regulatory network of SPAPB1A11.04c?

Several cutting-edge approaches hold promise for comprehensively mapping the SPAPB1A11.04c regulatory network:

  • Single-cell multi-omics integration: Combining single-cell RNA-seq with single-cell ATAC-seq or CUT&Tag could reveal cell-to-cell variability in SPAPB1A11.04c activity and target gene expression, potentially uncovering regulatory relationships masked in bulk analyses.

  • Proximity-based labeling approaches: BioID or APEX2 fusions with SPAPB1A11.04c could identify proteins that interact with or are in close proximity to SPAPB1A11.04c at chromatin, revealing co-factors and other components of its regulatory complexes.

  • In vivo footprinting with high-resolution approaches: Techniques like ChIP-exo or CUT&RUN provide near base-pair resolution of protein-DNA interactions, allowing precise mapping of SPAPB1A11.04c binding sites and potential detection of composite sites with other factors.

  • Synthetic regulatory circuit analysis: Construction of synthetic promoters with various configurations of SPAPB1A11.04c binding sites could help define the grammar of its regulatory logic and the impact of binding site number, spacing, and orientation.

  • Global genetic interaction mapping: Systematic genetic interaction screens using technologies like CRISPRi-seq could identify genes that functionally interact with SPAPB1A11.04c, revealing buffering relationships and parallel pathways.

  • 4D nucleome approaches: Techniques like Hi-C or Micro-C combined with SPAPB1A11.04c perturbations could reveal how this transcription factor influences three-dimensional genome organization and long-range chromatin interactions.

  • Integrated network modeling: Machine learning approaches that integrate multiple data types (transcriptomics, chromatin accessibility, protein-DNA binding, protein-protein interactions) could build predictive models of SPAPB1A11.04c's regulatory network.

  • Evolutionary comparative genomics: Analysis of SPAPB1A11.04c binding sites and target genes across multiple yeast species could reveal conserved core regulatory networks versus species-specific adaptations.

These approaches, particularly when used in combination, have the potential to move beyond individual target gene identification toward a systems-level understanding of how SPAPB1A11.04c functions within the broader transcriptional regulatory landscape of S. pombe.

How might SPAPB1A11.04c function integrate with other cellular signaling pathways?

SPAPB1A11.04c likely integrates with multiple signaling pathways to coordinate transcriptional responses with cellular states:

  • Copper sensing and homeostasis pathways: Given SPAPB1A11.04c/Mca1's role in regulating the copper transporter Mfc1 during copper starvation , it likely interfaces with cellular copper sensing mechanisms. Research should explore:

    • Potential interactions with known copper sensors

    • Post-translational modifications of SPAPB1A11.04c in response to copper levels

    • Cross-talk with other metal homeostasis pathways

  • Cell cycle signaling networks: SPAPB1A11.04c shows periodic activity patterns and regulates gene modules in M and G1 phases , suggesting integration with cell cycle control mechanisms:

    • Potential regulation by cyclin-dependent kinases

    • Coordination with other phase-specific transcription factors

    • Integration with checkpoint signaling pathways

  • Stress response pathways: Many transcription factors with Zn(2)-Cys(6) domains respond to various stresses. Investigation should focus on:

    • Potential activation by stress-activated protein kinases

    • Overlap with targets of stress-responsive transcription factors like Atf1 and Pcr1

    • Role in mediating cross-protection between different stress responses

  • Nutrient sensing pathways: Explore connections to:

    • TOR signaling pathway components

    • Glucose sensing and carbon metabolism regulators

    • Nitrogen availability response mechanisms

  • Chromatin modification pathways: Investigate interactions with:

    • Histone modifiers that affect chromatin accessibility

    • Chromatin remodeling complexes that may facilitate SPAPB1A11.04c binding

    • Non-coding RNAs that might regulate SPAPB1A11.04c activity

  • Meiotic regulation network: Given its role during meiosis , examine:

    • Coordination with master meiotic regulators

    • Integration with meiotic checkpoint mechanisms

    • Regulation by meiosis-specific kinases and phosphatases

Experimental approaches to investigate these integrations should include:

  • Phosphoproteomics to identify signaling-dependent modifications of SPAPB1A11.04c

  • Epistasis analysis with components of various signaling pathways

  • Perturbation studies combining environmental signals with genetic manipulations

  • Temporal analysis of SPAPB1A11.04c activity following pathway activation/inhibition

What emerging technologies will advance our understanding of SPAPB1A11.04c function?

Several emerging technologies hold particular promise for advancing our understanding of SPAPB1A11.04c function:

  • CRISPR-based epigenome editing: Technologies like CRISPR-dCas9 fused to activators or repressors could enable precise manipulation of SPAPB1A11.04c expression or targeted recruitment to specific genomic loci, allowing causal testing of regulatory relationships.

  • Live-cell imaging of transcription dynamics: MS2/MCP or PP7/PCP systems for visualizing nascent transcription, combined with fluorescently tagged SPAPB1A11.04c, could reveal the dynamics of transcriptional activation at individual target genes in real-time.

  • Nanopore direct RNA sequencing: Long-read direct RNA sequencing can simultaneously detect RNA sequence, modification, and structure, potentially revealing how SPAPB1A11.04c regulation affects not just expression levels but also post-transcriptional processing of target RNAs.

  • Spatial transcriptomics: Techniques for measuring gene expression with spatial resolution could reveal whether SPAPB1A11.04c targets show specialized expression patterns within specific cellular compartments.

  • Cryo-electron tomography: Advanced structural biology approaches could visualize SPAPB1A11.04c in complex with DNA and other transcriptional machinery components in near-native states.

  • Systematic protein engineering: Approaches like deep mutational scanning combined with functional assays could comprehensively map how sequence variations in SPAPB1A11.04c affect its activity and specificity.

  • Microfluidics-based single-cell perturbation: Systems allowing precise control of cellular environments while monitoring single-cell responses could reveal how SPAPB1A11.04c activity responds to dynamic changes in conditions like copper availability.

  • Massively parallel reporter assays: Testing thousands of variant binding sites or promoter architectures in parallel could define the sequence and structural determinants of SPAPB1A11.04c binding and activation.

  • Condensate biology approaches: Techniques for studying biomolecular condensates could reveal whether SPAPB1A11.04c participates in phase-separated transcriptional complexes that concentrate regulatory machinery at specific genomic loci.

  • In situ structural biology: Emerging methods like cryo-electron microscopy of cellular sections could potentially visualize SPAPB1A11.04c binding to chromatin in its native nuclear context.

The integration of these technologies with existing approaches will enable a more comprehensive understanding of SPAPB1A11.04c function across multiple scales, from atomic structure to cellular networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.