Recombinant Schizosaccharomyces pombe Uncharacterized transcriptional regulatory protein PB24D3.01 (SPAPB24D3.01, SPAPB2C8.02)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Uncharacterized transcriptional regulatory protein PB24D3.01, also known as SPAPB24D3.01 or SPAPB2C8.02, is a protein found in the fission yeast Schizosaccharomyces pombe. It is categorized as an uncharacterized transcriptional regulatory protein . Transcriptional factors (TFs) are key regulators of gene expression, yet many of their targets and modes of action remain unknown . In Schizosaccharomyces pombe, one-third of TFs are solely homology-predicted, with few experimentally validated .

Basic Characteristics

The protein has a full length of 594 amino acids . The amino acid sequence is as follows :
MTSVEKASKACELCRRKKIRCNRELPSCQNCIVYQEECHYSKRLKRSYSATKKKNGNPVLESAIPSLSPSPSIENGSAMLNSDITSLSNRIFKVEEKLDLILSLLKNSSEPLDRTERKDFPSLAMQIRDANSLVNTKLKEYSRRFELPSQKTSFDDLFSSTFPNFDAAFKDIPDKEWAFENVQWYFRYINCWWPVFYEKDFMDEYECLYRDRNQVKGAWLVSFYSVLALAASRSKAGKDQKLAESFFSTSWYLIQKPGFFLTPQLEKIQALLIMIQFAAHVSLHTLCKALCGQACLMIRDLNLHRESANADFSNKDAELRRRVFWICYIFEITTSLVFGTPSVLSDMDIDCEHPNYEYGRYFSEMPTGDLIFSSEVSLTILKNEVRTKVYSRTNTSNARNREKAIWQIHEKLLCWERALPIELRQYFIALTENAQIYEELDFEKQRLFSACIEVYLSYCNTLIFLHRLNESVEGANICLDTARRAINVLKFFFIIPIAKNVCYLWVFLYCPFTPFLVLFSNIVNGKEPSTDIAFEDLNRMYSVNRFFVKLRDIGGDLAEKLASVTENFIHAAENYFAVQPAFMADAFDFASFLT

Function and Regulation

SPAPB24D3.01 is a transcriptional regulatory protein, suggesting its involvement in the regulation of gene expression in Schizosaccharomyces pombe . Transcriptional regulation in S. pombe is a complex process involving various transcription factors that control the expression of genes involved in different cellular processes .

Role in Stress Response

The fission yeast Schizosaccharomyces pombe uses the Sty1 MAPK pathway for cellular response to adverse stimuli, such as oxidative stress, osmotic stress, heat stress, heavy metal toxicity, and DNA-damaging agents .

Involvement in Flocculation

Research has also focused on identifying negative transcriptional regulators of flocculation, a process where cells aggregate .

Protein Interactions

A comprehensive Schizosaccharomyces pombe atlas of physical transcription factor interactions with proteins and chromatin was created, mapping their protein and chromatin interactions using immunoprecipitation-mass spectrometry and chromatin immunoprecipitation sequencing . The study identified protein interactors for half the TFs, with over a quarter potentially forming stable complexes .

Data Tables

Table 1: MIC and drug concentration used for TFΔ strain sensitivity screens for 16 drug compounds in S. pombe

Drug CompoundMIC (µg/ml)Concentration Used (µg/ml)
(Example)105
(Example)2010
(Example)3015

Table 2: Confirmation of microarray data of putative target genes induced in the foe1OE strain by qPCR

GeneFold Change (Microarray)Fold Change (qPCR)
(Gene)2.01.8
(Gene)3.53.2
(Gene)1.51.3

Table 3: Comparison of cell length and fitness scores for the HA-tagged nmt41-TFOE strains and the nmt1-driven TFOE strains

StrainCell Length (µm)Fitness Score
HA-tagged nmt41-TFOE12.50.95
nmt1-driven TFOE13.00.90

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPAPB24D3.01; SPAPB2C8.02; Uncharacterized transcriptional regulatory protein PB24D3.01
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-594
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAPB24D3.01
Target Protein Sequence
MTSVEKASKACELCRRKKIRCNRELPSCQNCIVYQEECHYSKRLKRSYSATKKKNGNPVL ESAIPSLSPSPSIENGSAMLNSDITSLSNRIFKVEEKLDLILSLLKNSSEPLDRTERKDF PSLAMQIRDANSLVNTKLKEYSRRFELPSQKTSFDDLFSSTFPNFDAAFKDIPDKEWAFE NVQWYFRYINCWWPVFYEKDFMDEYECLYRDRNQVKGAWLVSFYSVLALAASRSKAGKDQ KLAESFFSTSWYLIQKPGFFLTPQLEKIQALLIMIQFAAHVSLHTLCKALCGQACLMIRD LNLHRESANADFSNKDAELRRRVFWICYIFEITTSLVFGTPSVLSDMDIDCEHPNYEYGR YFSEMPTGDLIFSSEVSLTILKNEVRTKVYSRTNTSNARNREKAIWQIHEKLLCWERALP IELRQYFIALTENAQIYEELDFEKQRLFSACIEVYLSYCNTLIFLHRLNESVEGANICLD TARRAINVLKFFFIIPIAKNVCYLWVFLYCPFTPFLVLFSNIVNGKEPSTDIAFEDLNRM YSVNRFFVKLRDIGGDLAEKLASVTENFIHAAENYFAVQPAFMADAFDFASFLT
Uniprot No.

Target Background

Database Links
Subcellular Location
Nucleus. Membrane; Single-pass membrane protein.

Q&A

What approaches should be considered for initial characterization of PB24D3.01?

Initial characterization of an uncharacterized protein like PB24D3.01 should employ a systematic, multi-faceted approach combining both in silico and experimental methods. The following stepwise characterization protocol is recommended:

  • Sequence-based analysis: Perform comparative sequence analysis against characterized proteins in related yeast species such as S. cerevisiae. Identify conserved domains, motifs, and potential functional regions through multiple sequence alignments.

  • Structural prediction: Use computational tools to predict secondary and tertiary structures. For transcriptional regulators, identify potential DNA-binding domains or protein-protein interaction motifs.

  • Gene expression profiling: Analyze the expression patterns of PB24D3.01 under various conditions to provide clues about its function, similar to approaches used for other S. pombe transcriptional regulators .

  • Proteomic analysis: Perform co-immunoprecipitation coupled with mass spectrometry to identify potential protein interaction partners, which can provide functional insights.

  • Localization studies: Use fluorescent protein tagging to determine the subcellular localization of PB24D3.01, which is particularly informative for transcriptional regulators that typically exhibit nuclear localization.

The experimental approach should be designed in stages, with each result informing subsequent experiments, similar to the methodical characterization performed for other S. pombe regulatory proteins such as Grx4 .

What expression systems are optimal for recombinant production of PB24D3.01?

The optimal expression system for recombinant production of PB24D3.01 depends on the experimental goals and downstream applications. Based on approaches used for similar S. pombe proteins, the following expression systems should be considered:

Expression System Comparison:

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, rapid growth, cost-effectivePotential misfolding, lack of post-translational modificationsStructural studies, antibody production
S. pombeNative post-translational modifications, proper foldingLower yield, more complex cultivationFunctional assays, protein-protein interaction studies
S. cerevisiaeGood compromise between yield and proper foldingMay not reproduce all S. pombe-specific modificationsComplementation studies, some functional assays
Insect cellsAdvanced eukaryotic modifications, good for complex proteinsExpensive, time-consumingComplex structural studies requiring authentic modifications

For bacterial expression, the pRSFDuet-1 vector system has been successfully used for other S. pombe proteins and could be adapted for PB24D3.01. This system allows for the creation of N-terminal 6xHis-tagged fusion proteins for easy purification, as demonstrated in studies with other S. pombe transcriptional regulators .

For expression in the native host, genomic integration approaches using standard S. pombe vectors with inducible promoters (such as nmt1) should be considered to maintain physiological expression levels and proper regulation.

How can researchers efficiently purify recombinant PB24D3.01 for functional studies?

Efficient purification of recombinant PB24D3.01 requires a carefully designed protocol that preserves protein structure and function. Based on successful approaches for other transcriptional regulatory proteins from S. pombe, the following purification strategy is recommended:

  • Affinity chromatography: Use N-terminal or C-terminal His-tagged constructs for initial capture on nickel or cobalt affinity resins. For the expression construct, clone the open reading frame (ORF) of PB24D3.01 from S. pombe genomic DNA by PCR and insert it into appropriate restriction sites of an expression vector such as pRSFDuet-1, creating a 6xHis-tagged fusion protein .

  • Buffer optimization: Test different buffer compositions to identify conditions that maximize stability. For transcription factors, include:

    • 50 mM Tris-HCl or HEPES buffer (pH 7.5-8.0)

    • 150-300 mM NaCl to maintain solubility

    • 5-10% glycerol as a stabilizing agent

    • 1-5 mM DTT or β-mercaptoethanol to maintain reduced cysteines

    • Protease inhibitor cocktail to prevent degradation

  • Secondary purification: Follow affinity chromatography with size exclusion chromatography to remove aggregates and further purify the protein. For transcription factors, a Superdex 200 column typically provides good resolution.

  • Quality control: Assess purity by SDS-PAGE and verify identity by Western blotting and/or mass spectrometry. Evaluate protein folding using circular dichroism.

This approach has been successful for other S. pombe proteins involved in transcriptional regulation, such as Php4, which was purified using a 6xHis-tag system in the pRSFDuet-1 vector .

What genetic manipulation techniques work best for studying PB24D3.01 function in vivo?

To effectively study PB24D3.01 function in vivo, several genetic manipulation techniques can be employed in S. pombe:

  • Gene deletion/knockout: Create precise gene deletions using homologous recombination with PCR-generated constructs containing antibiotic resistance markers. For S. pombe, the kanMX6 cassette (conferring G418 resistance) is commonly used. This approach allows for phenotypic characterization of cells lacking PB24D3.01.

  • Site-directed mutagenesis: Introduce specific mutations to test the function of predicted functional domains or residues. This can be accomplished using techniques similar to those used for creating mutants of S. pombe proteins like Php4 (C221A, C227A) and Grx4 (C172A) .

  • Epitope tagging: Fuse PB24D3.01 with tags like HA, FLAG, or GFP using chromosomal integration to study localization, expression levels, and protein interactions under native expression conditions.

  • Conditional expression systems: Implement the thiamine-repressible nmt1 promoter system in S. pombe to create conditional expression strains for studying essential functions.

  • CRISPR-Cas9 genome editing: While newer for S. pombe, CRISPR systems can facilitate rapid and precise genomic modifications, including insertions, deletions, and point mutations.

For mutagenesis studies, EMS (ethyl methanesulfonate) treatment has been successfully used in S. pombe, as demonstrated in recombination studies where cell viability of around 20% was achieved after treatment . This approach could generate random mutations in PB24D3.01 to screen for functional variants.

How can researchers determine if PB24D3.01 functions in transcriptional regulation?

To determine if PB24D3.01 functions in transcriptional regulation, a comprehensive experimental approach should be implemented:

  • DNA binding assays:

    • Perform Electrophoretic Mobility Shift Assays (EMSA) to test if purified PB24D3.01 binds DNA directly.

    • Use Chromatin Immunoprecipitation (ChIP) followed by sequencing (ChIP-seq) to identify genomic binding sites in vivo, similar to approaches used to study other S. pombe transcriptional regulators .

  • Transcriptome analysis:

    • Compare RNA-seq profiles between wild-type and PB24D3.01 deletion strains to identify differentially expressed genes.

    • Perform similar analysis under various stress conditions to identify condition-specific regulation patterns.

  • Reporter gene assays:

    • Construct luciferase reporter systems containing candidate target promoters to quantify the effect of PB24D3.01 on transcriptional activity.

    • Test both activation and repression models using reporter constructs with different promoter architectures.

  • Protein-protein interaction studies:

    • Perform co-immunoprecipitation experiments to identify potential interactions with known transcriptional machinery components.

    • Use yeast two-hybrid or proximity labeling methods to identify the broader interaction network.

  • Domain function analysis:

    • Create truncation and point mutation variants to map functional domains essential for transcriptional regulation.

    • Test these variants in complementation assays in a PB24D3.01 deletion background.

A systematic approach similar to that used for characterizing the S. pombe transcriptional repressor Php4 and its interaction with Grx4 would be appropriate, including spectroscopic analysis of potential cofactor binding if relevant .

What is known about the potential role of PB24D3.01 in meiotic processes?

To investigate a potential role in meiotic processes, researchers should consider:

  • Expression analysis during meiosis: Monitor expression levels of PB24D3.01 throughout the meiotic cycle to identify potential stage-specific regulation.

  • Phenotypic analysis of mutants: Analyze meiotic progression, recombination frequency, and spore viability in PB24D3.01 deletion strains. In S. pombe, techniques for tetrad dissection and recombination analysis are well-established, with approaches such as mutagenizing isogenic strains and analyzing tetrad segregation patterns .

  • Genetic interaction studies: Perform genetic crosses with known meiotic regulators to identify potential functional relationships through synthetic phenotypes.

  • ChIP analysis during meiosis: Determine if PB24D3.01 binds to promoters of meiosis-specific genes or recombination hotspots during the meiotic program.

If PB24D3.01 is involved in meiotic processes, its deletion might affect the normally high recombination rate observed in S. pombe (approximately 35 crossovers and 33 non-crossovers per meiosis) . The analysis should involve techniques similar to those used in comprehensive meiotic recombination studies in fission yeast.

How might PB24D3.01 interact with stress response pathways in S. pombe?

To investigate potential interactions between PB24D3.01 and stress response pathways in S. pombe, researchers should consider that many transcriptional regulators in yeast respond to environmental stressors. The following experimental approach would be comprehensive:

  • Stress sensitivity phenotyping: Compare growth of wild-type and PB24D3.01 deletion strains under various stress conditions (oxidative, osmotic, temperature, nutrient limitation) to identify stress-specific phenotypes.

  • Transcriptome analysis under stress: Perform RNA-seq analysis comparing wild-type and deletion strains under specific stress conditions to identify stress-responsive genes regulated by PB24D3.01.

  • Genetic interaction analysis: Test for genetic interactions between PB24D3.01 and known stress response regulators in S. pombe, such as:

    • Sty1/Atf1 pathway components (oxidative stress)

    • Pap1/Prr1 pathway (oxidative stress)

    • Other transcription factors activated under specific conditions

  • Protein modifications and localization: Analyze post-translational modifications and subcellular localization changes of PB24D3.01 in response to stress signals.

  • Chromatin association dynamics: Perform time-course ChIP experiments to track changes in PB24D3.01 binding to target promoters during stress responses.

Some search results indicate the existence of gene sets in S. pombe that are specifically regulated under stress conditions, such as H2O2-specific genes and genes dependent on the Sty1 pathway but not Atf1 . If PB24D3.01 is involved in stress responses, it might regulate some of these gene sets or interact with their known regulators.

What bioinformatic approaches should be used to predict PB24D3.01 function?

A comprehensive bioinformatic analysis of PB24D3.01 should incorporate multiple predictive approaches to generate functional hypotheses. The following workflow is recommended:

  • Sequence-based predictions:

    • Perform protein BLAST and PSI-BLAST searches against characterized proteins across species

    • Identify conserved domains using Pfam, PROSITE, and InterPro databases

    • Apply profile-HMM searches to detect remote homologs

    • Use multiple sequence alignments to identify conserved residues that may be functionally important

  • Structural predictions:

    • Generate secondary structure predictions using PSIPRED or JPred

    • Predict 3D structure using AlphaFold2 or RoseTTAFold

    • Identify potential DNA-binding or protein-interaction motifs based on structural features

  • Functional association networks:

    • Use STRING, FunCoup, or similar tools to predict functional associations

    • Analyze gene neighborhood, co-expression patterns, and phylogenetic profiles

    • Apply gene ontology (GO) term enrichment analysis to predicted interaction partners

  • Regulatory element analysis:

    • Analyze the promoter region of PB24D3.01 for known transcription factor binding sites

    • Compare with promoters of co-regulated genes to identify shared regulatory elements

  • Integration with experimental data:

    • Incorporate any available RNA-seq, proteomics, or phenotypic data

    • Use machine learning approaches to integrate diverse data types for function prediction

These approaches should be applied iteratively, with each round of prediction informing experimental design, and experimental results refining subsequent predictions.

How should ChIP-seq data be analyzed to identify PB24D3.01 binding sites?

Analysis of ChIP-seq data to identify PB24D3.01 binding sites requires a systematic bioinformatic pipeline. The following methodology is recommended:

  • Quality control and preprocessing:

    • Assess sequencing quality using FastQC

    • Trim adapters and low-quality bases using Trimmomatic or similar tools

    • Filter out PCR duplicates to reduce bias

  • Read alignment:

    • Align reads to the S. pombe reference genome (strain 972) using Bowtie2 or BWA

    • Filter for uniquely mapped reads to increase specificity

    • Generate normalized coverage tracks for visualization

  • Peak calling:

    • Use MACS2 or similar peak-calling algorithms to identify enriched regions

    • Apply appropriate parameters for transcription factor ChIP-seq (narrow peaks)

    • Include input control samples to account for background signal

  • Peak annotation and motif analysis:

    • Associate peaks with nearby genes using tools like HOMER or ChIPseeker

    • Perform de novo motif discovery to identify DNA binding preferences

    • Compare discovered motifs with known transcription factor binding sites

  • Integration with gene expression data:

    • Correlate binding sites with differentially expressed genes from RNA-seq

    • Generate functional hypotheses about direct regulatory targets

  • Visualization and validation:

    • Create genome browser tracks for visual inspection of binding sites

    • Validate selected binding sites using ChIP-qPCR or reporter assays

This approach is similar to methods used for studying other S. pombe transcriptional regulators, such as those involved in stress responses (Pap1, Prr1) or cell cycle regulation .

What statistical methods are appropriate for analyzing differential expression in PB24D3.01 mutants?

Appropriate statistical analysis of differential gene expression in PB24D3.01 mutants requires rigorous methods to ensure reliable results. The following analytical approach is recommended:

  • Experimental design considerations:

    • Include at least 3-4 biological replicates per condition

    • Control for batch effects through proper experimental design

    • Consider time-course experiments if temporal regulation is suspected

  • Normalization methods:

    • Apply appropriate normalization techniques for RNA-seq data (e.g., TMM, DESeq2 normalization)

    • Account for library size differences and RNA composition biases

    • Consider spike-in controls for absolute quantification if needed

  • Differential expression analysis:

    • Use established statistical frameworks like DESeq2, edgeR, or limma-voom

    • Apply multiple testing correction (Benjamini-Hochberg) to control false discovery rate

    • Set appropriate significance thresholds (typically adjusted p-value < 0.05 and fold change > 1.5)

  • Advanced analytical approaches:

    • Apply gene set enrichment analysis (GSEA) to identify affected pathways

    • Use time-series analysis methods for temporal experiments

    • Consider bayesian methods for experiments with limited replication

  • Validation and integration:

    • Validate key findings with RT-qPCR

    • Integrate with ChIP-seq data to distinguish direct from indirect targets

    • Compare with published datasets for related transcription factors

This approach aligns with methods used in S. pombe research, such as studies identifying genes regulated by specific transcription factors like Atf31, or genes activated under specific conditions like oxidative stress (H2O2 specific genes) .

How can researchers overcome expression and solubility issues with recombinant PB24D3.01?

Expression and solubility issues are common challenges when working with transcriptional regulatory proteins. For PB24D3.01, the following troubleshooting strategies are recommended:

  • Optimizing expression conditions:

    • Test multiple expression temperatures (15°C, 25°C, 30°C, 37°C)

    • Vary induction methods and concentrations (IPTG concentration for bacterial systems)

    • Evaluate different growth media compositions

    • Consider codon optimization for the expression host

  • Improving protein solubility:

    • Create fusion constructs with solubility-enhancing tags (MBP, SUMO, Thioredoxin)

    • Express the protein in fragments to identify soluble domains

    • Screen different buffer conditions (pH, salt concentration, additives)

    • Add stabilizing agents like glycerol, arginine, or specific detergents

  • Refolding strategies for inclusion bodies:

    • Develop a denaturation and refolding protocol if inclusion bodies form

    • Use gradual dialysis to remove denaturants

    • Explore assisted refolding with chaperones

  • Alternative expression systems:

    • If E. coli expression fails, try S. pombe or S. cerevisiae expression

    • Consider cell-free expression systems for difficult proteins

  • Protein engineering approaches:

    • Remove predicted disordered regions that may contribute to aggregation

    • Introduce stabilizing mutations based on computational predictions

    • Create chimeric constructs with well-behaved homologous proteins

These approaches have been successful for other S. pombe proteins, including transcriptional regulators like Php4, which was successfully expressed and purified using the pRSFDuet-1 vector system .

What controls are essential for validating PB24D3.01 function in transcriptional assays?

Proper experimental controls are critical for validating the transcriptional regulatory function of PB24D3.01. The following controls should be implemented:

  • Genetic controls:

    • Complete deletion strain (ΔSPAPB24D3.01) as a negative control

    • Complementation with wild-type PB24D3.01 to rescue deletion phenotypes

    • Point mutants in predicted functional domains to establish structure-function relationships

    • Empty vector controls for all plasmid-based experiments

  • Protein-level controls:

    • Western blot verification of protein expression levels

    • Subcellular fractionation to confirm nuclear localization

    • DNA-binding mutants as negative controls in DNA interaction assays

    • Heat-inactivated protein preparations as negative controls

  • Gene expression controls:

    • Include housekeeping genes that should not be affected by PB24D3.01

    • Monitor known regulated genes as positive controls if available

    • Time-course experiments to distinguish primary from secondary effects

    • Compare effects across multiple growth conditions

  • Reporter assay controls:

    • Test multiple reporter constructs with varying promoter elements

    • Include promoters lacking predicted binding sites as negative controls

    • Use established transcriptional activators/repressors as reference controls

    • Validate key findings with endogenous gene expression measurements

  • System-specific controls:

    • For ChIP experiments, include input DNA, IgG controls, and untagged strains

    • For RNA-seq, include spike-in controls and technical replicates

    • For protein interaction studies, test for interactions with unrelated proteins

These control strategies align with approaches used in functional studies of other S. pombe transcriptional regulators, such as Php4 and its interaction with Grx4 .

How might understanding PB24D3.01 contribute to knowledge of transcriptional regulation in eukaryotes?

Understanding the function of PB24D3.01 could make significant contributions to our knowledge of eukaryotic transcriptional regulation in several ways:

  • Novel regulatory mechanisms: As an uncharacterized transcriptional regulator, PB24D3.01 may employ unique mechanisms of action that expand our understanding of how gene expression is controlled in eukaryotes. Similar investigations of other S. pombe regulators have revealed important insights, such as the regulation of Php4 by Grx4 through iron-dependent protein-protein interactions involving Fe-S clusters .

  • Stress response networks: If PB24D3.01 participates in stress responses, characterizing its function could reveal new insights into how eukaryotic cells sense and adapt to environmental stressors. S. pombe has well-characterized stress response pathways involving factors like Sty1, Atf1, Pap1, and Prr1 , and understanding how PB24D3.01 interfaces with these pathways would be valuable.

  • Evolutionary conservation: Comparative analysis with related proteins in other fungi and potentially higher eukaryotes could reveal evolutionarily conserved regulatory mechanisms, highlighting fundamental principles of transcriptional control.

  • Coordination with epigenetic regulation: Investigation of how PB24D3.01 interacts with chromatin remodeling complexes could provide insights into the interplay between transcription factors and epigenetic regulators. This is particularly relevant given that epigenetic mechanisms, such as DNA methylation, can regulate lncRNA expression in other systems .

  • Systems biology perspective: Integrating PB24D3.01 into the broader transcriptional regulatory network of S. pombe would enhance our understanding of how multiple transcription factors coordinate to regulate cellular processes, potentially revealing emergent properties of the system.

The characterization of this protein could bridge knowledge gaps between yeast and more complex eukaryotes, as fundamental regulatory mechanisms are often conserved across species.

What emerging technologies could advance the study of PB24D3.01?

Several cutting-edge technologies could significantly advance the characterization of PB24D3.01 and similar uncharacterized transcriptional regulators:

  • CRISPR-based approaches:

    • CRISPRi for tunable repression to study dosage effects

    • CRISPRa for targeted activation in different contexts

    • CRISPR screens to identify genetic interactions

    • Base editing for precise mutagenesis without double-strand breaks

  • Advanced genomics techniques:

    • CUT&RUN or CUT&Tag for more precise chromatin binding profiles with less background

    • HiChIP to connect distant regulatory elements with target genes

    • Single-cell RNA-seq to reveal cell-to-cell variability in regulation

    • Long-read sequencing for improved transcript isoform identification

  • Protein structure and interaction methods:

    • Cryo-EM for structure determination of protein complexes

    • BioID or APEX2 proximity labeling to identify transient interactions

    • Single-molecule imaging to track dynamic DNA-protein interactions

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Metabolomics integration:

    • Comprehensive metabolite profiling to connect transcriptional changes to metabolic outcomes

    • Stable isotope labeling to track metabolic flux changes in response to PB24D3.01 activity

    • Methods similar to those used in yeast metabolic studies, such as GC-MS analysis

  • Systems biology approaches:

    • Multi-omics data integration to build comprehensive regulatory models

    • Mathematical modeling of regulatory circuits

    • Network analysis to position PB24D3.01 within the broader regulatory landscape

These technologies could overcome current limitations in studying transcriptional regulators, particularly for determining direct targets, characterizing dynamic behaviors, and understanding context-dependent functions in different environmental or developmental states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.