Recombinant Schizosaccharomyces pombe Uncharacterized transmembrane protein C1672.14 (SPCC1672.14) is a protein derived from the fission yeast Schizosaccharomyces pombe . SPCC1672.14 is considered an uncharacterized protein, also referred to as a "sequence orphan," indicating its function has not yet been determined through experimentation .
The amino acid sequence for SPCC1672.14 is as follows :
MEESPRVEKEREKRTIRNVKNKKKKVSTYFILIIILWFISLFQLQQCNLHAYSNYYKVIFILILITTLDSLPYSNYNAMIHLLISSNTLPLPPCFTLRASLFPPFITPLTHWNVGFVRLCNLFLSSHFHPLFHLTNSAPGSRQISTSLSNNTQST
The SPCC1672.14 gene is present in Schizosaccharomyces pombe 972h- . Entrez Gene ID for this gene is 14217380 . It is a protein-coding gene, and has mRNA sequence NM_001355882.1 and protein sequence NP_001343182.1 .
Recombinant SPCC1672.14 is produced using an in vitro E. coli expression system . It is available from some suppliers as a recombinant protein for research purposes . It can also be found as cDNA ORF clones .
S. pombe itself serves as an excellent homologous expression system for SPCC1672.14, offering proper protein folding and post-translational modifications. Current research demonstrates that using the nmt1 promoter for constitutive expression via plasmid or chromosomal integration provides significant advantages, particularly when high glucose concentrations are present in the media . For heterologous expression, while P. pastoris and S. cerevisiae are alternatives, comparative proteome analyses indicate that S. pombe maintains competitive advantage for transmembrane protein expression due to its membrane composition and secretory pathway characteristics .
Optimization requires systematic assessment of multiple parameters:
For transmembrane proteins like SPCC1672.14, a multi-step approach is recommended:
Cell lysis under optimal conditions (4°C, protease inhibitors)
Membrane fraction isolation via differential centrifugation
Solubilization using appropriate detergents (test panel including DDM, CHAPS)
Affinity chromatography utilizing engineered tags
Size exclusion chromatography for final polishing
For quantitative analysis, procedures similar to those employed in comparative proteome studies would be appropriate, including protein concentration determination via Bradford assay, alkylation with IAA, and buffer exchange using ultrafiltration .
For this uncharacterized transmembrane protein, a multi-technique approach is essential:
When reporting SAS data, follow the updated template that includes scattering profiles (I(q) versus q), dimensionless Kratky plots, and pairwise distance distribution functions .
This requires complementary biochemical and biophysical approaches:
Blue native PAGE analysis: Allows assessment of native protein complexes
Chemical crosslinking followed by MS analysis: Identifies interacting partners and interfaces
FRET analysis with fluorescently tagged constructs: Provides evidence of proximity in living cells
Size exclusion chromatography with multi-angle light scattering: Determines absolute molecular weight of protein complexes
When documenting assembly composition, clearly report heterodimer or other oligomeric states as observed in comparable structural studies .
As an uncharacterized transmembrane protein, multiple parallel strategies are recommended:
Gene knockout/knockdown: Create deletion mutants to assess phenotypic consequences, particularly under stress conditions
Localization studies: Determine subcellular compartmentalization using fluorescent protein fusions
Interactome analysis: Identify binding partners through co-immunoprecipitation followed by MS
Comparative proteomics: Assess changes in global proteome upon deletion/overexpression using isobaric labeling approaches such as iTRAQ
Metabolic profiling: Determine impacts on cellular metabolism, particularly lipid metabolism given S. pombe's responses to stress
Given S. pombe's well-characterized stress responses, particularly heat stress adaptation through membrane modification , several targeted experiments are appropriate:
Compare growth and viability of wild-type versus SPCC1672.14 deletion strains under various stressors (heat, osmotic, oxidative)
Conduct quantitative proteomics using isobaric labeling to compare proteome changes during stress between wild-type and mutant strains
Analyze membrane lipid composition changes during stress response, focusing on:
Monitor stress signaling pathways activation through phosphoproteomics
Research indicates that membrane-associated proteins often participate in stress sensing and signaling, and metabolic crosstalk between membrane and storage lipids facilitates homeostatic maintenance during heat stress .
While primarily characterized as a transmembrane protein, some membrane proteins have dual localization or interact with chromatin-associated factors:
ChIP-seq methodology: Use tagged versions of SPCC1672.14 with appropriate controls to identify potential DNA binding sites
Quantitative proteomic analysis: Apply techniques from chromatin-bound protein studies in S. pombe
Validation strategies: Confirm any observed nuclear localization through subcellular fractionation and immunoblotting
Functional significance: Assess transcriptional changes upon deletion/overexpression of SPCC1672.14
The experimental design should borrow concepts from established ChIP-on-chip approaches that determine DNA binding sites for proteins of interest .
CRISPR-Cas9 applications in S. pombe require specific optimizations:
Guide RNA design: Consider S. pombe genome specificity and potential off-target effects
Delivery method: Optimize transformation protocols for S. pombe
Homology-directed repair templates: Design with sufficient homology arms (>500 bp)
Verification strategies: Combine sequencing with functional assays to confirm successful editing
Phenotypic analysis: Compare edited strains with conventional deletion mutants to confirm consistency
A systematic analytical pipeline is recommended:
Sample preparation: Follow validated protocols for cell lysate preparation including protease inhibitors, alkylation with IAA, and buffer exchange
Quantitative approach: Use isobaric labeling (e.g., iTRAQ) with an internal standard approach
Mass spectrometry: Implement two-dimensional LC coupled to MALDI MS for comprehensive coverage
Bioinformatic analysis: Apply statistical methods to identify significantly changed proteins
Pathway analysis: Map changes to biological pathways and cellular processes
Validation: Confirm key findings using orthogonal techniques (Western blotting, RT-qPCR)
When analyzing structural data, particularly from techniques like small-angle scattering:
Data quality assessment: Evaluate linearity in Guinier plots, proper error estimation
Model validation: Compare experimental data with theoretical scattering profiles
Multiple model comparison: Generate ensemble of possible structures
Cross-validation: Integrate data from complementary techniques (EM, crystallography)
Reporting standards: Follow updated templates for biomolecular structural modeling
The structural analysis should include chain length (amino acid count), theoretical weight, source organism information, and appropriate assembly composition description .
Publication-quality reporting should include:
Sample details: Protein concentration, buffer composition, purity assessment
Data collection parameters: Instrument configuration, temperature, exposure time
Structural parameters: Radius of gyration (Rg), maximum dimension (Dmax)
Model validation: Fit quality indicators, validation against independent measurements
Visualization: Scattering profiles, Kratky plots, pairwise distance distribution functions
Data deposition: Coordinates and experimental data in appropriate databases
The structural analysis should follow established reporting templates that include molecular mass (48.41 kDa for comparison proteins) .
When facing conflicting data:
Methodological reconciliation: Evaluate differences in experimental conditions, sample preparation, or analytical techniques
Sequential validation: Design experiments that can distinguish between competing hypotheses
Combined interpretation: Develop models that account for apparently contradictory results
Biological context: Consider whether differences reflect physiological regulation or experimental artifacts
Transparent reporting: Document all contradictions with possible explanations