Recombinant Schizosaccharomyces pombe Uncharacterized transmembrane protein C1672.14 (SPCC1672.14)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Uncharacterized transmembrane protein C1672.14 (SPCC1672.14) is a protein derived from the fission yeast Schizosaccharomyces pombe . SPCC1672.14 is considered an uncharacterized protein, also referred to as a "sequence orphan," indicating its function has not yet been determined through experimentation .

Basic Characteristics

CharacteristicDescription
OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Gene NameSPCC1672.14
Protein TypeTransmembrane protein
Uniprot No.G2TRU2
Sequence Length155 amino acids
Molecular WeightInformation not available in the provided documents.
Tag InfoN-terminal 10xHis-tagged or to be determined during production process
Expression Region1-155

Amino Acid Sequence

The amino acid sequence for SPCC1672.14 is as follows :
MEESPRVEKEREKRTIRNVKNKKKKVSTYFILIIILWFISLFQLQQCNLHAYSNYYKVIFILILITTLDSLPYSNYNAMIHLLISSNTLPLPPCFTLRASLFPPFITPLTHWNVGFVRLCNLFLSSHFHPLFHLTNSAPGSRQISTSLSNNTQST

Gene Information

The SPCC1672.14 gene is present in Schizosaccharomyces pombe 972h- . Entrez Gene ID for this gene is 14217380 . It is a protein-coding gene, and has mRNA sequence NM_001355882.1 and protein sequence NP_001343182.1 .

Production and Availability

Recombinant SPCC1672.14 is produced using an in vitro E. coli expression system . It is available from some suppliers as a recombinant protein for research purposes . It can also be found as cDNA ORF clones .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
SPCC1672.14; Putative uncharacterized transmembrane protein SPCC1672.14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC1672.14
Target Protein Sequence
MEESPRVEKEREKRTIRNVKNKKKKVSTYFILIIILWFISLFQLQQCNLHAYSNYYKVIF ILILITTLDSLPYSNYNAMIHLLISSNTLPLPPCFTLRASLFPPFITPLTHWNVGFVRLC NLFLSSHFHPLFHLTNSAPGSRQISTSLSNNTQST
Uniprot No.

Q&A

What expression systems are optimal for recombinant SPCC1672.14 production?

S. pombe itself serves as an excellent homologous expression system for SPCC1672.14, offering proper protein folding and post-translational modifications. Current research demonstrates that using the nmt1 promoter for constitutive expression via plasmid or chromosomal integration provides significant advantages, particularly when high glucose concentrations are present in the media . For heterologous expression, while P. pastoris and S. cerevisiae are alternatives, comparative proteome analyses indicate that S. pombe maintains competitive advantage for transmembrane protein expression due to its membrane composition and secretory pathway characteristics .

How do I optimize growth conditions to maximize SPCC1672.14 yield?

Optimization requires systematic assessment of multiple parameters:

ParameterRecommendationRationale
Media compositionAdd underrepresented amino acids based on protein composition analysisProteome analysis reveals amino acid biosynthesis upregulation when secreting high protein levels; supplementation increased secretion 1.5-fold
Membrane fluidityConsider fluconazole addition to decrease ergosterol levelsModified membrane composition improved protein secretion by 2.1-fold
Temperature25-30°C range, monitor with time-course experimentsBalances protein production rate with proper folding
Carbon sourceGlucose concentration should be experimentally determinedHigh glucose affects nmt1 promoter activity and cellular stress responses
Protein extractionMechanical disruption with glass beads in appropriate bufferStandard method for cell lysis extraction in S. pombe

What purification strategy yields highest purity for functional studies of SPCC1672.14?

For transmembrane proteins like SPCC1672.14, a multi-step approach is recommended:

  • Cell lysis under optimal conditions (4°C, protease inhibitors)

  • Membrane fraction isolation via differential centrifugation

  • Solubilization using appropriate detergents (test panel including DDM, CHAPS)

  • Affinity chromatography utilizing engineered tags

  • Size exclusion chromatography for final polishing

For quantitative analysis, procedures similar to those employed in comparative proteome studies would be appropriate, including protein concentration determination via Bradford assay, alkylation with IAA, and buffer exchange using ultrafiltration .

What approaches are most suitable for determining SPCC1672.14 membrane topology?

For this uncharacterized transmembrane protein, a multi-technique approach is essential:

When reporting SAS data, follow the updated template that includes scattering profiles (I(q) versus q), dimensionless Kratky plots, and pairwise distance distribution functions .

How can I determine if SPCC1672.14 forms oligomeric structures in the membrane?

This requires complementary biochemical and biophysical approaches:

  • Blue native PAGE analysis: Allows assessment of native protein complexes

  • Chemical crosslinking followed by MS analysis: Identifies interacting partners and interfaces

  • FRET analysis with fluorescently tagged constructs: Provides evidence of proximity in living cells

  • Size exclusion chromatography with multi-angle light scattering: Determines absolute molecular weight of protein complexes

When documenting assembly composition, clearly report heterodimer or other oligomeric states as observed in comparable structural studies .

What are the most effective approaches for determining SPCC1672.14 function?

As an uncharacterized transmembrane protein, multiple parallel strategies are recommended:

  • Gene knockout/knockdown: Create deletion mutants to assess phenotypic consequences, particularly under stress conditions

  • Localization studies: Determine subcellular compartmentalization using fluorescent protein fusions

  • Interactome analysis: Identify binding partners through co-immunoprecipitation followed by MS

  • Comparative proteomics: Assess changes in global proteome upon deletion/overexpression using isobaric labeling approaches such as iTRAQ

  • Metabolic profiling: Determine impacts on cellular metabolism, particularly lipid metabolism given S. pombe's responses to stress

How can I investigate whether SPCC1672.14 is involved in stress response pathways?

Given S. pombe's well-characterized stress responses, particularly heat stress adaptation through membrane modification , several targeted experiments are appropriate:

  • Compare growth and viability of wild-type versus SPCC1672.14 deletion strains under various stressors (heat, osmotic, oxidative)

  • Conduct quantitative proteomics using isobaric labeling to compare proteome changes during stress between wild-type and mutant strains

  • Analyze membrane lipid composition changes during stress response, focusing on:

    • Fatty acid saturation levels

    • Triglyceride (TG) formation

    • Metabolic crosstalk between membrane and storage lipids

  • Monitor stress signaling pathways activation through phosphoproteomics

Research indicates that membrane-associated proteins often participate in stress sensing and signaling, and metabolic crosstalk between membrane and storage lipids facilitates homeostatic maintenance during heat stress .

How can I apply chromatin immunoprecipitation techniques to study potential nuclear functions of SPCC1672.14?

While primarily characterized as a transmembrane protein, some membrane proteins have dual localization or interact with chromatin-associated factors:

  • ChIP-seq methodology: Use tagged versions of SPCC1672.14 with appropriate controls to identify potential DNA binding sites

  • Quantitative proteomic analysis: Apply techniques from chromatin-bound protein studies in S. pombe

  • Validation strategies: Confirm any observed nuclear localization through subcellular fractionation and immunoblotting

  • Functional significance: Assess transcriptional changes upon deletion/overexpression of SPCC1672.14

The experimental design should borrow concepts from established ChIP-on-chip approaches that determine DNA binding sites for proteins of interest .

What are the considerations for conducting CRISPR-based genome editing to study SPCC1672.14?

CRISPR-Cas9 applications in S. pombe require specific optimizations:

  • Guide RNA design: Consider S. pombe genome specificity and potential off-target effects

  • Delivery method: Optimize transformation protocols for S. pombe

  • Homology-directed repair templates: Design with sufficient homology arms (>500 bp)

  • Verification strategies: Combine sequencing with functional assays to confirm successful editing

  • Phenotypic analysis: Compare edited strains with conventional deletion mutants to confirm consistency

How should I analyze comparative proteomics data to identify SPCC1672.14 function?

A systematic analytical pipeline is recommended:

  • Sample preparation: Follow validated protocols for cell lysate preparation including protease inhibitors, alkylation with IAA, and buffer exchange

  • Quantitative approach: Use isobaric labeling (e.g., iTRAQ) with an internal standard approach

  • Mass spectrometry: Implement two-dimensional LC coupled to MALDI MS for comprehensive coverage

  • Bioinformatic analysis: Apply statistical methods to identify significantly changed proteins

  • Pathway analysis: Map changes to biological pathways and cellular processes

  • Validation: Confirm key findings using orthogonal techniques (Western blotting, RT-qPCR)

What statistical approaches are most appropriate for analyzing structural data for SPCC1672.14?

When analyzing structural data, particularly from techniques like small-angle scattering:

  • Data quality assessment: Evaluate linearity in Guinier plots, proper error estimation

  • Model validation: Compare experimental data with theoretical scattering profiles

  • Multiple model comparison: Generate ensemble of possible structures

  • Cross-validation: Integrate data from complementary techniques (EM, crystallography)

  • Reporting standards: Follow updated templates for biomolecular structural modeling

The structural analysis should include chain length (amino acid count), theoretical weight, source organism information, and appropriate assembly composition description .

What information must be included when reporting SPCC1672.14 structural characterization?

Publication-quality reporting should include:

  • Sample details: Protein concentration, buffer composition, purity assessment

  • Data collection parameters: Instrument configuration, temperature, exposure time

  • Structural parameters: Radius of gyration (Rg), maximum dimension (Dmax)

  • Model validation: Fit quality indicators, validation against independent measurements

  • Visualization: Scattering profiles, Kratky plots, pairwise distance distribution functions

  • Data deposition: Coordinates and experimental data in appropriate databases

The structural analysis should follow established reporting templates that include molecular mass (48.41 kDa for comparison proteins) .

How should contradictory results in SPCC1672.14 characterization be addressed?

When facing conflicting data:

  • Methodological reconciliation: Evaluate differences in experimental conditions, sample preparation, or analytical techniques

  • Sequential validation: Design experiments that can distinguish between competing hypotheses

  • Combined interpretation: Develop models that account for apparently contradictory results

  • Biological context: Consider whether differences reflect physiological regulation or experimental artifacts

  • Transparent reporting: Document all contradictions with possible explanations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.