Recombinant Schizosaccharomyces pombe Uncharacterized transmembrane protein C343.21 (SPAC343.21)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please specify it in your order; we will prioritize its implementation.
Synonyms
SPAC343.21; Uncharacterized transmembrane protein C343.21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC343.21
Target Protein Sequence
MVSYNVLTKLFFIFSGGLVFFFFEFFLNHFNYYPTKLLYYITFYFIKNHPSLFLLFNFFL STASFSYSFPSKSHLTFYSKGAPSVFFLSLKSSPCPGYCSSTLLYSTSNLLPSLPSPLHA PPPLGSRLLHVFFYRRSNASAYPSFTPRYSFFPSFTLR
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What approaches can be used to characterize the genomic context of SPAC343.21?

Understanding the genomic context of SPAC343.21 requires a multi-faceted approach. Researchers should begin with bioinformatic analysis using the PomBase database (https://www.pombase.org) to identify neighboring genes and potential operons. Comparative genomic analysis across different Schizosaccharomyces species can reveal evolutionary conservation patterns. For experimental validation, techniques such as 5' and 3' RACE (Rapid Amplification of cDNA Ends) should be employed to confirm transcription start and termination sites. ChIP-seq approaches can identify transcription factor binding sites in the promoter region, which may provide clues to regulation mechanisms.

When working with uncharacterized proteins in S. pombe, it's valuable to consider the regulatory mechanisms studied in known systems such as the mating-type switching apparatus, where regulation involves complex interactions between DNA replication, heterochromatin formation, and specialized protein complexes .

How should researchers approach preliminary functional prediction for SPAC343.21?

Initial functional prediction requires a systematic multi-tool approach. Begin with transmembrane topology prediction using TMHMM, TOPCONS, and Phobius, comparing outputs for consensus. Protein domain prediction with InterPro, Pfam, and SMART can identify conserved domains. Subsequently, employ multiple sequence alignment with MUSCLE or CLUSTALW to identify conserved residues across orthologs, which often indicate functional importance.

For S. pombe proteins, drawing parallels with characterized transmembrane proteins in related pathways can provide valuable insights. Utilize Gene Ontology (GO) term enrichment analysis of proteins with similar structural features. Modeling approaches like AlphaFold can generate structural predictions, while tools like STRING can predict protein-protein interaction networks. These computational predictions should guide hypothesis formation for subsequent wet-lab validation experiments.

What are effective methods for analyzing SPAC343.21 expression patterns?

Analysis of SPAC343.21 expression patterns should employ complementary approaches. Quantitative real-time PCR (qRT-PCR) provides sensitive detection of transcript levels across different conditions, including nutrient limitation, cell cycle phases, and stress responses. RNA-seq offers genome-wide context for expression analysis, allowing comparison with co-regulated genes. For protein-level analysis, western blotting with epitope-tagged constructs or custom antibodies enables detection across conditions.

For real-time expression tracking, researchers should consider creating a GFP-fusion construct using homologous recombination at the endogenous locus to maintain native regulation. Time-lapse microscopy can then visualize dynamic expression patterns, while flow cytometry quantifies expression at the population level. S. pombe's tractable genetics facilitates these approaches, allowing creation of reporter strains similar to those used in mating-type studies that employed CFP and YFP under the control of mating-type-specific promoters .

What is the recommended workflow for investigating subcellular localization of SPAC343.21?

A comprehensive workflow for subcellular localization involves multiple complementary approaches. Begin with fluorescent protein tagging (GFP or mCherry) at either N- or C-terminus with appropriate linker sequences to minimize interference with transmembrane domains. Test both orientations, as tag position can affect localization. Express the fusion protein from the native promoter through genomic integration to maintain physiological expression levels.

Confocal microscopy with co-localization markers for organelles (nucleus, ER, Golgi, plasma membrane) provides initial localization data. For higher resolution, employ super-resolution microscopy (STORM, PALM) or electron microscopy with immunogold labeling. To confirm localization, conduct subcellular fractionation followed by western blotting. Dynamic properties can be assessed using FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility. In S. pombe, microscopy techniques have been successfully employed to track protein localization during various cellular processes, providing a methodological framework for similar studies with SPAC343.21.

What gene knockout strategies are most appropriate for initial SPAC343.21 functional studies?

For functional characterization through gene knockout, researchers should implement a multi-stage strategy. First, employ a complete gene deletion using homologous recombination with antibiotic selection markers (kanMX6 or hphMX6), as commonly used in the S. pombe deletion library . This requires designing primers with 80-100bp homology regions flanking the SPAC343.21 open reading frame.

After obtaining knockout strains, conduct comprehensive phenotypic analysis including growth rate measurements in various media, microscopic examination of cellular morphology, and cell cycle analysis using flow cytometry. Test for sensitivity to environmental stresses (temperature, osmotic stress, oxidative stress) and cell wall/membrane perturbing agents.

If the knockout is lethal, employ conditional systems like the tetracycline-regulatable promoter or temperature-sensitive degron tags. For essential genes, partial loss-of-function through domain-specific mutations may provide functional insights. Complementation studies with orthologs from related species can elucidate evolutionary conservation of function. The phenotypic characterization approach should be similar to that employed in the mating-type switching study, where fluorescence-based reporter systems enabled high-throughput screening of gene deletion libraries .

How can researchers design comprehensive protein-protein interaction studies for SPAC343.21?

Investigating protein-protein interactions for transmembrane proteins like SPAC343.21 requires specialized approaches. Begin with proximity-dependent biotin identification (BioID) or TurboID, which are particularly valuable for transmembrane proteins as they capture transient interactions in native cellular environments. Fuse the biotin ligase to SPAC343.21, express in S. pombe, and identify biotinylated proteins by mass spectrometry after streptavidin pulldown.

Complementary approaches include split-ubiquitin yeast two-hybrid systems specifically designed for membrane proteins, and co-immunoprecipitation using cross-linking agents such as DSP (dithiobis(succinimidyl propionate)) to stabilize membrane protein complexes before solubilization. For in vitro validation, microscale thermophoresis or surface plasmon resonance with purified protein domains can quantify interaction affinities.

Integration of interaction data with known S. pombe protein complexes, such as the simplified SMN complex identified in S. pombe , provides context for understanding potential functional associations. Visualization tools like Cytoscape enable network analysis to identify key interaction hubs and potential functional modules.

What are the optimal approaches for studying post-translational modifications of SPAC343.21?

Studying post-translational modifications (PTMs) of transmembrane proteins requires specialized methodology. Begin with computational prediction using tools like NetPhos, SUMOplot, and UbPred to identify potential modification sites. For experimental validation, express epitope-tagged SPAC343.21 in S. pombe and immunoprecipitate under conditions that preserve modifications (phosphatase inhibitors, deubiquitinase inhibitors).

Mass spectrometry analysis should employ multiple proteolytic enzymes to maximize sequence coverage, with enrichment strategies for specific modifications: titanium dioxide for phosphopeptides, anti-diGly antibodies for ubiquitination sites. Targeted mass spectrometry (MRM/PRM) can quantify stoichiometry of modifications at specific residues.

To determine functional significance, create non-modifiable mutants (e.g., S/T to A for phosphorylation sites) and phosphomimetic mutations (S/T to D/E) and assess their impact on localization, interactions, and cellular phenotypes. In parallel, use inhibitors of relevant modifying enzymes to assess global effects on SPAC343.21 function. Understanding PTMs can reveal regulatory mechanisms similar to those observed in other S. pombe protein complexes where protein modifications play crucial roles in function and localization .

What strategies are recommended for resolving the structure of SPAC343.21?

Structural determination of transmembrane proteins presents significant challenges. For SPAC343.21, researchers should implement a multi-technique approach. Begin with predictive modeling using AlphaFold2 and RoseTTAFold to generate initial structural hypotheses. For experimental structure determination, consider:

  • X-ray crystallography: Express individual hydrophilic domains separately to overcome crystallization challenges. Utilize fusion tags like T4 lysozyme or BRIL to enhance crystallization propensity of transmembrane regions.

  • Cryo-electron microscopy: For full-length protein, employ single-particle cryo-EM with detergent solubilization or nanodiscs to maintain native-like lipid environment.

  • NMR spectroscopy: Appropriate for individual domains or small transmembrane segments using selective isotopic labeling (15N, 13C) in minimal media.

Cross-validation between computational predictions and experimental data enhances confidence in structural models. Molecular dynamics simulations can further refine structures and predict dynamic behaviors in membrane environments. Similar approaches have been successfully applied to determine structures of S. pombe protein complexes, as demonstrated in the structural analysis of the SMN complex .

How should researchers approach evolutionary analysis of SPAC343.21 across fungal species?

A comprehensive evolutionary analysis requires integrating sequence, structural, and functional data. Begin by identifying orthologs across fungi using reciprocal BLAST searches against curated databases (UniProt, FungiDB). Expand to more distant homologs using sensitive profile-based methods like PSI-BLAST and HMMER.

Generate multiple sequence alignments with MAFFT or T-Coffee, optimized for transmembrane proteins. Construct phylogenetic trees using maximum likelihood (RAxML) or Bayesian inference (MrBayes) methods with appropriate substitution models for transmembrane proteins. Calculate sequence conservation scores and map onto structural models to identify functionally constrained regions.

Analyze selective pressure using dN/dS ratios to identify positively selected sites. Compare gene neighborhood conservation (synteny analysis) across species to reveal evolutionary constraints on genomic context. Integrating functional data from characterized orthologs in model organisms can provide insights into conserved functions. This evolutionary approach has proven valuable in understanding the conservation and diversification of protein systems in S. pombe, as seen with the simplified SMN complex compared to its more complex counterparts in higher eukaryotes .

What methods are most effective for integrating SPAC343.21 into known cellular pathways?

Pathway integration requires combining multiple data types with network analysis. Begin with transcriptomic analysis (RNA-seq) comparing wild-type and SPAC343.21 deletion/overexpression strains under various conditions to identify co-regulated genes. Perform metabolomic profiling to detect changes in metabolite levels that may indicate pathway involvement.

Synthetic genetic interaction screens using systematic gene deletion/silencing (e.g., with the S. pombe deletion library ) can reveal genetic interactions that often indicate pathway relationships. Analyze these interactions using clustering algorithms to position SPAC343.21 within known functional modules.

Phosphoproteomic analysis after SPAC343.21 perturbation can identify signaling pathways affected by its presence/absence. Integration of all datasets should employ network visualization tools like Cytoscape with pathway enrichment analysis using tools like GO enrichment and KEGG pathway analysis.

For validation, targeted experiments examining key pathway components identified in the global analyses should be conducted. Similar integrative approaches have been used to understand the roles of proteins in S. pombe cellular pathways, such as the mating-type switching pathway, where multiple components work in concert to achieve directional recombination .

What expression systems provide optimal yields for recombinant SPAC343.21?

Optimal expression of transmembrane proteins like SPAC343.21 requires careful selection of expression systems. For prokaryotic expression, E. coli C41(DE3) or C43(DE3) strains specifically engineered for membrane proteins should be considered, using vectors with tunable promoters like pBAD to prevent toxicity from overexpression. For eukaryotic expression, Pichia pastoris offers advantages in proper folding and post-translational modifications of fungal proteins.

The expression protocol should include:

  • Codon optimization for the selected expression host

  • Addition of purification tags (His8, Twin-Strep) with TEV protease cleavage sites

  • Fusion partners like GFP or MBP to monitor expression and enhance solubility

  • Induction at reduced temperatures (16-20°C) to promote proper folding

  • Screening different detergents (DDM, LMNG, GDN) for solubilization

For co-expression of interacting partners, the MultiBAC or pETDuet systems can be employed. Expression levels should be monitored by in-gel fluorescence (for GFP fusions) or western blotting. A systematic approach testing multiple constructs with varying domain boundaries often identifies optimal expression constructs.

What purification strategies maximize yield and stability of SPAC343.21?

Purification of transmembrane proteins requires specialized approaches to maintain stability. Begin with affinity purification using immobilized metal affinity chromatography (IMAC) for His-tagged constructs or Strep-Tactin for Strep-tagged proteins. Optimize buffer conditions by screening:

  • Detergent types and concentrations (mild non-ionic detergents like DDM, LMNG)

  • Lipid additives (cholesterol, specific phospholipids) to stabilize native conformation

  • pH ranges (typically 7.0-8.0) and salt concentrations (150-500 mM NaCl)

  • Stabilizing additives (glycerol 5-10%, reducing agents like DTT or TCEP)

Following affinity purification, employ size exclusion chromatography to isolate monodisperse protein and remove aggregates. For higher purity, consider ion exchange chromatography as an intermediate step. For structural studies, detergent exchange to amphipols or reconstitution into nanodiscs can enhance stability.

Protein quality should be assessed by analytical size exclusion chromatography, negative-stain electron microscopy, and thermal stability assays (CPM or DSF). These approaches are similar to those used for purification of protein complexes from S. pombe, such as the SMN complex, which required optimization of buffer conditions and purification strategies to maintain complex integrity .

How can researchers develop effective antibodies against SPAC343.21 for research applications?

Developing antibodies against transmembrane proteins presents unique challenges. Begin with epitope selection using bioinformatic tools to identify hydrophilic, surface-exposed regions with high predicted antigenicity. Select 2-3 regions, preferably from different domains including extramembrane loops and termini.

For polyclonal antibodies, synthesize peptides (15-20 amino acids) corresponding to the selected epitopes, conjugate to carrier proteins (KLH or BSA), and immunize rabbits with a prime-boost regimen. Validate antibody specificity using:

  • Western blotting with wild-type vs. SPAC343.21 deletion strains

  • Peptide competition assays to confirm epitope specificity

  • Immunoprecipitation followed by mass spectrometry

For monoclonal antibodies, consider immunizing mice with purified protein domains or virus-like particles displaying SPAC343.21 extramembrane regions. Screen hybridoma clones for specificity against native protein using flow cytometry with intact cells.

For applications requiring higher specificity, develop nanobodies or recombinant antibody fragments using phage display libraries screened against purified SPAC343.21. These smaller antibody formats often provide better access to epitopes in complex membrane proteins.

What are the most effective CRISPR-Cas9 strategies for editing SPAC343.21 in S. pombe?

CRISPR-Cas9 editing in S. pombe for SPAC343.21 modification requires optimization of several parameters. Design guide RNAs targeting unique sequences in SPAC343.21 using S. pombe-specific CRISPR design tools that account for the organism's PAM preferences. Typically, 2-3 guides should be designed per target region to maximize success rates.

The expression system should use promoters with appropriate strength in S. pombe, such as the rrk1 promoter for Cas9 and the U6 snRNA promoter for guide RNAs. Cas9 should include a nuclear localization signal optimized for S. pombe.

For homology-directed repair, design repair templates with:

  • 500-1000 bp homology arms flanking the cut site

  • Silent mutations in the PAM or guide sequence to prevent re-cutting

  • Selection markers compatible with S. pombe (kanMX6, hphMX6, natMX6)

Deliver the CRISPR components using plasmid transformation or RNP delivery, optimizing transformation protocols for efficiency. Validate edits by PCR, sequencing, and phenotypic analysis. For precise edits without markers, employ negative selection strategies or transient expression systems.

This approach builds upon established genetic modification techniques in S. pombe, which have been successfully used to create reporter strains and gene deletions for studying various cellular processes, including mating-type switching .

What approaches can resolve contradictory results in SPAC343.21 localization studies?

Resolving contradictory localization results requires systematic troubleshooting and validation. Begin by examining potential technical variables:

  • Tag interference: Test both N- and C-terminal tags with various linker lengths to minimize functional disruption

  • Expression levels: Compare native promoter expression vs. overexpression systems

  • Fixation artifacts: Compare live-cell imaging with different fixation methods

  • Cell cycle dependence: Synchronize cells and observe localization throughout the cell cycle

  • Condition specificity: Test multiple growth conditions, stresses, and nutrient states

For validation, employ complementary approaches:

  • Immunofluorescence with antibodies against the native protein

  • Subcellular fractionation followed by western blotting

  • Proximity labeling methods (BioID, APEX) to confirm microenvironments

  • Super-resolution microscopy for detailed localization

Create functional reporter systems where protein activity correlates with localization, similar to the dual reporter system using CFP and YFP that was employed in S. pombe mating-type studies . Document all experimental conditions meticulously, as seemingly minor variables can significantly impact localization of membrane proteins.

How should RNA-seq data be analyzed to identify genes co-regulated with SPAC343.21?

RNA-seq analysis for co-regulation studies requires a systematic bioinformatic workflow. Begin with quality control using FastQC, followed by trimming of low-quality reads and adapters using Trimmomatic. Align reads to the S. pombe genome using HISAT2 or STAR, optimized for splice junction detection.

For differential expression analysis:

  • Quantify gene expression using featureCounts or HTSeq

  • Normalize counts using DESeq2 or edgeR to account for library size differences

  • Compare SPAC343.21 mutant strains to wild-type across conditions

  • Apply appropriate statistical thresholds (padj < 0.05, |log2FC| > 1)

For co-expression analysis:

  • Calculate Pearson or Spearman correlation coefficients across multiple conditions

  • Perform Weighted Gene Co-expression Network Analysis (WGCNA) to identify modules

  • Use k-means or hierarchical clustering to group genes with similar expression patterns

Validation should include qRT-PCR for selected genes and comparison with existing datasets in PomBase. Pathway enrichment analysis of co-regulated genes using GO terms or KEGG pathways can reveal functional associations. This approach parallels methods used in comprehensive studies of S. pombe gene regulation, where transcriptomic analysis has revealed functional relationships between genes .

What statistical approaches are appropriate for phenotypic analysis of SPAC343.21 mutants?

Rigorous statistical analysis of phenotypic data requires appropriate experimental design and analytical methods. Begin with power analysis to determine sample sizes needed for detecting expected effect sizes. For growth rate comparisons, employ two-way ANOVA to assess genotype effects across conditions, with Tukey's post-hoc test for multiple comparisons.

For microscopy-based phenotypes:

  • Ensure unbiased sampling with automated image acquisition

  • Quantify multiple parameters (cell size, shape, fluorescence intensity)

  • Apply mixed-effects models to account for experiment-to-experiment variation

  • Use non-parametric tests (Mann-Whitney U) for non-normally distributed data

For high-dimensional data (e.g., metabolomics):

  • Perform principal component analysis (PCA) for dimension reduction

  • Apply PERMANOVA for multivariate significance testing

  • Use false discovery rate (FDR) correction for multiple hypothesis testing

Reproducibility should be ensured through biological replicates from independent transformations/isolates. Report effect sizes with confidence intervals rather than just p-values. Create comprehensive phenotypic profiles by integrating multiple assays, similar to the approach used in large-scale screening of S. pombe deletion mutants for mating-type switching defects .

How can researchers distinguish direct from indirect effects in SPAC343.21 functional studies?

Distinguishing direct from indirect effects requires triangulation from multiple experimental approaches. Begin with acute perturbation systems that allow temporal control of SPAC343.21 function:

  • Auxin-inducible degron (AID) tags for rapid protein depletion

  • Temperature-sensitive alleles for conditional inactivation

  • Chemical-genetic approaches using engineered sensitivity to small molecules

Monitor early responses (0-30 minutes) after perturbation using:

  • Phosphoproteomics to detect immediate signaling changes

  • ChIP-seq for chromatin binding proteins to identify genomic targets

  • Metabolic labeling with SILAC or TMT for nascent protein synthesis

For validation, perform in vitro reconstitution with purified components to demonstrate sufficiency. Epistasis analysis can establish pathway relationships by creating double mutants with known pathway components. Time-course experiments tracking cellular responses provide insights into the sequence of events following SPAC343.21 perturbation.

Computational approaches including causal network inference from time-series data can help build models distinguishing direct from indirect relationships. These strategies parallel approaches used to dissect complex pathways in S. pombe, such as the mating-type switching pathway where genetic interaction analyses helped establish the relationships between multiple components .

What approaches are recommended for integrating proteomics and transcriptomics data in SPAC343.21 studies?

Multi-omics data integration requires specialized computational strategies. Begin with separate analysis of each data type, normalizing and transforming appropriately. For correlation analysis between protein and mRNA levels, use rank-based methods (Spearman) that are robust to different dynamic ranges.

For integrated pathway analysis:

  • Identify differentially expressed genes/proteins using modality-specific tools

  • Map both datasets to common identifiers (gene IDs)

  • Perform Gene Set Enrichment Analysis (GSEA) on combined rankings

  • Apply multivariate methods like sparse Partial Least Squares (sPLS) to identify co-varying features

Visualization tools like Cytoscape with multiomics plugins can display relationships between transcripts and proteins in network context. For temporal studies, apply dynamic Bayesian networks to model causal relationships between transcript and protein changes.

Validation experiments should target discordant changes (where protein and mRNA levels diverge) to identify post-transcriptional regulation. Integration with public datasets can provide context, similar to approaches used in comprehensive studies of S. pombe where multiple data types were integrated to understand complex cellular processes .

How should researchers design experiments to determine if SPAC343.21 functions within known S. pombe protein complexes?

Experimental design for complex association studies should employ complementary approaches. Begin with affinity purification coupled with mass spectrometry (AP-MS) using SPAC343.21 as bait under native conditions. Use SILAC or TMT labeling to distinguish specific from non-specific interactions. Crosslinking mass spectrometry (XL-MS) with reagents like DSS can capture transient interactions and provide structural constraints.

For validation of specific complex associations:

  • Co-immunoprecipitation with antibodies against known complex components

  • Fluorescence microscopy with dual labeling to assess co-localization

  • FRET or BiFC assays to confirm direct interactions in living cells

  • Sucrose gradient fractionation to determine if SPAC343.21 co-sediments with known complexes

Genetic interaction screens with members of candidate complexes can reveal functional relationships. Comparing interaction profiles with those of known complex members provides additional evidence. Perturbation experiments targeting complex assembly can reveal dependencies between components.

When designing these experiments, consider the methodologies used to identify and characterize protein complexes in S. pombe, such as the SMN complex, which was identified through a combination of biochemical approaches and subsequently characterized structurally . Similar strategies could reveal whether SPAC343.21 participates in known complexes or forms novel assemblies with other proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.