Recombinant Schizosaccharomyces pombe Uncharacterized transporter C5D6.04 (SPAC5D6.04)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

Gene Identification:

  • Systematic ID: SPAC5D6.04 (Entrez Gene ID: 2541955) .

  • Classification: Protein-coding gene predicted to encode an auxin family transmembrane transporter .

Protein Features:

  • Sequence: Partial sequence (452 amino acids) with the N-terminal sequence:
    MGFFSSLGQINVWSLLRPIIESDLEVIVIALGGYVLAKKGFLPRDAQK... .

  • Domains: Contains transmembrane helices consistent with transporter activity .

  • Orthologs: Homologs exist in Eremothecium gossypii, Neurospora crassa, and Saccharomyces cerevisiae, suggesting evolutionary conservation .

Research Context and Functional Predictions

Role in Nutrient Transport:

  • SPAC5D6.04 is part of a broader family of transmembrane transporters in S. pombe regulated by TOR (Target of Rapamycin) signaling, which coordinates nutrient uptake and cellular growth .

  • While uncharacterized, its predicted function aligns with transporters like Can1 (arginine transporter) and Ght3 (hexose transporter), which modulate fitness under nutrient stress .

Table 1: Comparative Transporter Roles in S. pombe

Gene IDNameFunctionSensitivity to Nutrient Stress
SPAC5D6.04C5D6.04Putative auxin transporterNot yet tested
SPBC18H10.16can1Arginine transmembrane transporterSensitive (glutamate, proline)
SPAC1F8.01ght3Hexose transporterSensitive (Torin1)

Recombinant Production and Applications

Expression Systems:

  • Host: Recombinant protein is expressed in yeast systems .

  • Tags: C-terminal DYKDDDDK (FLAG) tag for detection/purification .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
SPAC5D6.04; Uncharacterized transporter C5D6.04
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC5D6.04
Target Protein Sequence
MGFFSSLGQINVWSLLRPIIESDLEVIVIALGGYVLAKKGFLPRDAQKVISSLNVYFFTP CLVFEKVGNGLNLKMLIDLSLLPVFYVIISAASILISFLLAKLFRLTPRQRNFATACITF QNSNSLPLALVSSLATTVKDLLWDKIPDDTPDKVASRGIMYLLIFSQLGQALRWSYGYRI LLSPNQPEDPLPIGNRSWSHSDVNEEEIQNLLASSANVDGVQNSVQANEGSTVQTDSSAI SKNDNVQVETSNEEVGGFGAASSKISKFIVLLLDFFSPPLYSLFIALFIAVVPPLQRFFF EEGSFVEGSITSGIRMAGQVAVPMILVVLGASLATDISKTEPTQEVRKNNDTRVIIVCLL GRMVVVPLALLPAFSLLSYFSEISTVDDPVFVVVIFLLVGSPTAIQLTQICQLNGVFERE CAKVLWWSYAVFTPPNSLLLAFASLLVVKWTK
Uniprot No.

Target Background

Database Links
Protein Families
Auxin efflux carrier (TC 2.A.69) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SPAC5D6.04 and what are its basic molecular characteristics?

SPAC5D6.04 is a protein-coding gene from Schizosaccharomyces pombe (fission yeast) that encodes a putative auxin family transmembrane transporter. The protein has the following key characteristics:

  • Entrez Gene ID: 2541955

  • RefSeq mRNA: NM_001018797.2

  • RefSeq protein: NP_593365.1

  • Coding sequence (CDS): 478..1836

  • Full protein length: 452 amino acids

The protein is currently classified as an "uncharacterized transporter," indicating that while its structure suggests transport function, the specific substrates and physiological role remain to be experimentally determined .

What are key considerations for designing experiments to characterize SPAC5D6.04 function?

When designing experiments to characterize SPAC5D6.04 function, researchers should:

  • Define clear variables: Establish independent variables (e.g., substrate concentration, environmental conditions) and dependent variables (e.g., transport activity, growth phenotypes) .

  • Develop testable hypotheses: Based on its classification as an auxin family transporter, formulate specific hypotheses about potential substrates and transport mechanisms .

  • Design appropriate controls: Include positive controls (known transporters with similar predicted function) and negative controls (non-functional mutants or unrelated transporters) .

  • Consider experimental treatments: Determine how to manipulate the independent variables to test the transporter's function. This may include varying substrate concentrations, pH, temperature, or competitive inhibitors .

  • Plan measurement methods: Decide how to quantify transport activity, which could include radioisotope uptake assays, fluorescent substrate analogs, or growth-based complementation assays .

The following table outlines an example experimental design framework:

Research questionIndependent variableDependent variablePotential confounding variablesControl method
Does SPAC5D6.04 transport auxin?Auxin concentrationAuxin uptake rateEndogenous auxin transportersUse S. cerevisiae expression system lacking auxin transporters
What is the substrate specificity of SPAC5D6.04?Different potential substratesTransport activityVarying expression levelsNormalize to protein expression levels
How does pH affect SPAC5D6.04 activity?pH of transport bufferTransport rateBuffer compositionUse consistent buffer systems across pH range

How can functional complementation approaches be used to study SPAC5D6.04?

Functional complementation is a powerful approach for studying uncharacterized transporters:

  • Select an appropriate host: Choose a mutant strain deficient in a transport function that SPAC5D6.04 might complement. For auxin transport, consider yeast strains lacking specific transporters .

  • Express the SPAC5D6.04 gene: Clone the full coding sequence into an appropriate expression vector with a suitable promoter for the host organism.

  • Assess phenotypic rescue: Determine if expression of SPAC5D6.04 restores the missing function in the mutant host.

  • Quantify complementation efficiency: Compare growth rates or direct transport measurements between complemented strains and controls.

This approach has been successfully used with other S. pombe transporters. For example, expression of the hexose transporters Ght1, Ght2, Ght5, and Ght6 in the S. cerevisiae mutant RE700A functionally complemented its D-glucose uptake-deficient phenotype . A similar strategy could be applied to investigate SPAC5D6.04's function by expressing it in transport-deficient mutants.

How can researchers determine the substrate specificity of SPAC5D6.04?

Determining substrate specificity requires a systematic approach:

  • Transport assays with labeled substrates: Use radioisotope or fluorescently labeled potential substrates to directly measure transport activity. For auxin transport, radiolabeled indole-3-acetic acid (IAA) could be used.

  • Competition assays: Measure inhibition of transport of a known substrate by unlabeled potential substrates. Strong inhibition suggests the compound may be a substrate or inhibitor.

  • Growth-based assays: If transport of the substrate is linked to growth, test the ability of various compounds to support growth in auxotrophic strains expressing SPAC5D6.04.

  • Kinetic analysis: Determine transport kinetics (Km and Vmax) for each potential substrate to identify preferred substrates.

The specificity testing could follow the approach used for characterizing the hexose transporters in S. pombe, where Ght1p, Ght2p, and Ght5p displayed significantly higher specificities for D-glucose than for D-fructose, while Ght6p exhibited a slightly higher affinity for D-fructose .

What techniques are suitable for studying the subcellular localization of SPAC5D6.04?

To determine the subcellular localization of SPAC5D6.04:

  • Fluorescent protein tagging: Create fusion proteins with GFP or other fluorescent tags to visualize localization via fluorescence microscopy. Consider both N- and C-terminal tags to determine which preserves function.

  • Immunolocalization: Generate antibodies against SPAC5D6.04 or use epitope tags for immunofluorescence microscopy.

  • Subcellular fractionation: Isolate different cellular compartments and detect the presence of SPAC5D6.04 using Western blotting.

  • Co-localization studies: Use markers for different cellular compartments (plasma membrane, organelles) to determine precise localization.

This approach has been used successfully with other transporters in S. pombe. For instance, the glutathione transporter Pgt1 was found to be localized to the plasma membrane using similar techniques .

What are effective strategies for recombinant expression of SPAC5D6.04?

Membrane proteins like SPAC5D6.04 present unique challenges for recombinant expression:

  • Expression system selection: Consider the following options:

    • Bacterial systems (E. coli): Fast and economical but may not properly fold eukaryotic membrane proteins

    • Yeast systems (S. cerevisiae): Better for eukaryotic membrane proteins, appropriate post-translational modifications

    • Insect cell systems: Higher expression levels for complex eukaryotic proteins

    • Mammalian cell systems: Best for maintaining native structure but more expensive and complex

  • Vector design considerations:

    • Include appropriate fusion tags for detection and purification (His-tag, FLAG-tag)

    • Consider using inducible promoters to control expression levels

    • Include appropriate secretion signals or localization sequences

  • Optimization parameters:

    • Expression temperature (lower temperatures often improve folding)

    • Induction conditions (concentration and timing)

    • Media composition and growth conditions

The commercially available recombinant SPAC5D6.04 is produced with a tag determined during the production process and is stored in a Tris-based buffer with 50% glycerol , suggesting that this approach has been successful for maintaining protein stability.

What purification challenges are specific to SPAC5D6.04 and how can they be addressed?

Purifying membrane transporters like SPAC5D6.04 involves several challenges:

  • Solubilization strategies:

    • Test multiple detergents (DDM, LMNG, CHAPS) for optimal solubilization while preserving structure

    • Consider adding lipids or cholesterol to stabilize the protein

    • Optimize detergent concentration and solubilization conditions

  • Purification approach:

    • Affinity chromatography using engineered tags (His-tag, FLAG-tag)

    • Size exclusion chromatography to separate protein-detergent complexes

    • Ion exchange chromatography for additional purification

  • Stability considerations:

    • Buffer optimization (pH, salt concentration, additives)

    • Addition of substrate or inhibitors to stabilize specific conformations

    • Storage conditions (glycerol concentration, temperature)

For the commercially available recombinant SPAC5D6.04, the recommended storage includes 50% glycerol in a Tris-based buffer at -20°C, with extended storage at -80°C. Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week .

How does SPAC5D6.04 compare to other characterized transporters in S. pombe?

Comparative analysis provides context for understanding SPAC5D6.04:

  • Sequence similarity: SPAC5D6.04 shows homology to auxin family transporters but appears distinct from the well-characterized hexose transporters (Ght1-Ght6) and the glutathione transporter (Pgt1) in S. pombe .

  • Structural comparison: Like other members of the major facilitator superfamily in S. pombe, SPAC5D6.04 is predicted to have 12 transmembrane domains, but the arrangement and specific amino acid composition of these domains likely differs to accommodate different substrates .

  • Evolutionary relationships: Phylogenetic analysis of S. pombe transporters has shown that the hexose transporter family clusters separately from monosaccharide transporters of other yeasts and humans . Similar analysis of SPAC5D6.04 could reveal its evolutionary relationships.

The following table compares key features of SPAC5D6.04 with other characterized transporters in S. pombe:

TransporterFamilyPredicted/Known FunctionKey Characteristics
SPAC5D6.04Auxin familyUncharacterized transmembrane transporter452 amino acids, 12 predicted transmembrane domains
Ght1-Ght6Hexose transporter familyGlucose/fructose transportVarying substrate specificities, Ght5 most prominently expressed
Pgt1 (SPAC29B12.10c)Oligopeptide transporter (OPT) familyHigh-affinity glutathione transportPlasma membrane localized, Km=63 μM for glutathione

What insights can be gained from studying orthologous proteins in related organisms?

Studying orthologous proteins can provide valuable insights:

  • Functional conservation: Investigate whether orthologs in related species have been characterized, which might suggest similar functions for SPAC5D6.04.

  • Structural features: Compare conserved domains and motifs across species to identify functionally important regions.

  • Expression patterns: Examine if orthologs share similar expression patterns or regulatory mechanisms.

Based on the search results, SPAC5D6.04 appears to have orthologs in several fungal species:

OrganismOrtholog GeneProtein ID
Eremothecium gossypiiAGOS_AFR126WNP_985673.1
Neurospora crassaNCU00589XP_965729.1
Kluyveromyces lactisKLLA0D06380gXP_453345.1
Saccharomyces cerevisiaeYBR287WNP_009846.1

Functional studies of these orthologs, if available, could provide clues about the role of SPAC5D6.04.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.