Recombinant Schizosaccharomyces pombe Uncharacterized ubiquitin-like protein C1E8.02 (SPBC1E8.02)

Shipped with Ice Packs
In Stock

Description

Genetic and Molecular Analysis

The gene encoding SPBC1E8.02 is found within the genome of Schizosaccharomyces pombe . Genetic studies involving S. pombe strains have utilized SPBC1E8.02 in experiments such as genetic screens for extragenic suppressors and analyses of gene expression under different conditions, such as nitrogen starvation . SPBC1E8.02 has been identified as one of the genes induced in Δ tsc1 and Δ tsc2 strains, but not in the wild-type strain, after nitrogen starvation . This suggests a role in the cellular response to nutrient availability and stress .

Experimental Uses

SPBC1E8.02 is used in research for various purposes, including:

  • Antibody Production: Recombinant SPBC1E8.02 is utilized as an immunogen to generate antibodies for protein detection and localization studies .

  • Protein Interaction Studies: It is employed in assays to identify interacting partners and elucidate its role in cellular pathways .

  • Structural Biology: SPBC1E8.02 is used in crystallization studies to determine its three-dimensional structure and understand its mechanism of action .

Table 1: SPBC1E8.02 Antibody Information

PropertyDescription
Product CodeCSB-PA524267XA01SXV
StorageUpon receipt, store at -20°C or -80°C. Avoid repeated freeze.
Uniprot No.O42967
ImmunogenRecombinant Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) SPBC1E8.02 protein
Raised InRabbit
Species ReactivitySchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Tested ApplicationsELISA, WB (ensure identification of antigen)
FormLiquid
ConjugateNon-conjugated
Storage BufferPreservative: 0.03% Proclin 300; Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Purification MethodAntigen Affinity Purified
IsotypeIgG
ClonalityPolyclonal
Product TypePolyclonal Antibody
Immunogen SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Lead TimeMade-to-order (14-16 weeks)
Target NamesSPBC1E8.02
UsageFor Research Use Only. Not for use in diagnostic or therapeutic procedures.

Table 2: List of ORFs induced upon nitrogen depletion in wild-type S. pombe but not in Δtsc1 or Δtsc2

ORF IDGene namePossible function
SPCP31B10.09Unknown
SPCC962.01
SPAC1039.04Membrane transporter
SPBC1773.17cGlycerate and formate dehydrogenase
SPBP26C9.01c
SPAC1039.01Amino acid permease
SPBC887.17Uracil permease
SPAC1399.02Membrane transporter
SPBP35G2.11cZinc finger protein
SPBC947.15cMitochondrial NADH dehydrogenase
SPAP7G5.06Amino acid permease
SPAC1039.03Esterase/lipase
SPBC24C6.06gpa1Guanine nucleotide-binding protein
SPAC13G7.04cmac1Membrane-anchored protein
SPAC27F1.05cAminotransferase
SPBC1604.03cHypothetical protein
SPCC1183.11MS ion channel
SPCC31H12.01
SPAC31G5.09cspk1MAP kinase
SPAC11D3.03cConserved protein
SPAC13F5.07cHypothetical protein
SPAC27D7.03cmei2RNA-binding protein
SPAC11H11.04mam2Pheromone P-factor receptor
SPAC186.04cPseudogene
SPBC1683.02Adenosine deaminase
SPBC660.07ntp1O-glycosyl hydrolase
SPBC1711.11Sorting nexin
SPBC36B7.05cPhosphatidylinositol(3)-phosphate-binding protein
SPBC25B2.02cmam1ABC transporter
SPBC2G5.09c
SPBPB2B2.01Amino acid permease
SPCC1682.11cHypothetical protein
SPCC550.07Acetamidase
SPCC550.10meu8Betaine aldehyde dehydrogenase
SPCC622.11Hypothetical protein

Table 3: List of ORFs induced in Δtsc1 and Δtsc2 but not in wild-type S. pombe

ORF IDGene namePossible function
SPAC21E11.04ppr1L-azetidine-2-carboxylic acid acetyltransferase
SPCC1020.14Tf2-12 tf2-5tf2-type transposon
SPCC794.05cPseudogene
SPAC9.04Tf2-1 tf2-7tf2-type transposon
SPAC26A3.13cTf2-4 tf2-2tf2-type transposon
SPCC1494.11cTf2-13-pseudoLTR retrotransposon tf2-type retrotransposon polyprotein with 1 frameshift
SPAC167.08Tf2-2 tf2-3 tf2-4tf2-type transposon
SPAC1F2.03
SPAC2E1P3.03ctf2-10 Tf2-3tf2-type transposon
SPAC2E1P3.03
SPBC9B6.02ctf2-8 Tf2-9Retrotransposable element
SPAPB18E9.03cHypothetical protein
SPBC1E8.04cTf2-10-pseudoFrameshifted LTR retrotransposon polyprotein
SPBC660.09Hypothetical protein
SPAC3F10.16cGTPase
SPBC1271.08cHypothetical protein
SPBC1271.07cAcetyltransferase
SPAC57A10.01pas1Pcl-like cyclin
SPAC19E9.03
SPBC2G2.04cmmf1 pmf1Conserved protein
SPBP4H10.12Conserved protein
SPAC821.10csod1Cu,Zn-superoxide dismutase
SPBC211.07cubc8Ubiquitin-conjugating enzyme
SPAC29B12.13Hypothetical protein
SPAC2F3.08sut1α-Glucoside transporter
SPCC1450.13cRiboflavin synthase
SPAC3C7.02cHypothetical protein
SPCC704.04cHypothetical protein
SPAC17H9.03inv1Beta-fructofuranosidase
SPAC19G1.09Hypothetical protein
SPCC1281.04chrr1Putative transcription factor
SPBC30D10.07Hypothetical protein
SPAC1834.11cfbp1Fructose-1,6-bisphosphatase

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPBC1E8.02; Uncharacterized ubiquitin-like protein C1E8.02
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-603
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC1E8.02
Target Protein Sequence
MSEYRIRVTTVDQKVGIFQVPRTKTVLELKELIAVTFEAPADRLKLIHAGRVLRNETPLE EILHDATDLVTFHLVIAVFNSTSTTLPSATSSSVPQSRTSELSSTNSIPTPRITSLNPEE LSRRERAQRLLQTYNSFHGSGLGGLFPNIHRELESHGFSLPTHEQSSPVAESLDNSVSSA LSPHLETLRRRNLSIHHQHIQAHEMAQESLETRNPGNISSSSAPLASDQSPTVSSNHIHA SGNLALGSNSGLNPRSPNSFSSPLDNPALHTVDSTNVNGSLSPLSNSSSINQVHQNETHG STISVPNPNLSQMGPSHSSSVPSNLSPNPAQNENPSTTSIPSINNQPFPSGLSASNSNFA SSSFIPQSVPQLLPIYYQTIFYNGNYYLQQLPSASPPTMFRDHSFAPLVSPSIVSPYGVL ENEETGECAFLFSPNASQPHFQPRAPTFGIPRNVRSLFTLPFFHTIRNIERHFRLFIRLA LFCVLTTYNVSLSQTILLTSIMSVVFLLQTGALAPFINDNPLIQSGMRHIRNLQDEYRRR RNRTAQRVVEIPNETQTEDEQDGTNTPDNRADAEERELTRSQRIYRTVVRTIVAFALSFV PRA
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is SPBC1E8.02 and why is it significant for research?

SPBC1E8.02 is an uncharacterized ubiquitin-like protein in the fission yeast Schizosaccharomyces pombe. It belongs to the ubiquitin protein family, which plays crucial roles in protein regulation, degradation pathways, and cellular signaling . Its significance lies in understanding the evolution and function of ubiquitin-like modifier systems across eukaryotes. S. pombe is an excellent model organism that shares more features with metazoan cells than S. cerevisiae does, making findings potentially more translatable to higher eukaryotes including humans .

How is SPBC1E8.02 classified within the ubiquitin-like protein family?

SPBC1E8.02 is classified as a predicted ubiquitin family protein based on sequence homology and structural predictions . Unlike well-characterized ubiquitin-like modifiers such as SUMO or FAT10, SPBC1E8.02 remains largely uncharacterized. To properly classify it, researchers should perform detailed sequence analysis using multiple sequence alignment tools to compare it with known ubiquitin-like modifiers, followed by phylogenetic analysis to determine its evolutionary relationship to other members of the family. Domain structure analysis using tools like InterPro, Pfam, or SMART can identify conserved ubiquitin domains and any unique structural features .

What experimental approaches are recommended for initial characterization of SPBC1E8.02?

For initial characterization of SPBC1E8.02, a multi-faceted approach is recommended:

  • Expression profiling: Determine when and where the protein is expressed using RNA-seq and quantitative proteomics

  • Subcellular localization: Generate fluorescently tagged versions (e.g., GFP-SPBC1E8.02) to track localization, similar to the approaches used for Dis2.NEGFP and Sds21.NEGFP characterization

  • Genetic analysis: Create knockout strains (Δspbc1e8.02) to observe phenotypic effects, followed by complementation studies

  • Initial interaction studies: Perform immunoprecipitation followed by mass spectrometry to identify binding partners

  • Basic structural analysis: Express and purify the recombinant protein for circular dichroism spectroscopy to determine secondary structure elements

These methods establish a foundation for further functional studies by providing insights into expression patterns, cellular localization, and potential interaction networks.

How should researchers design experiments to determine if SPBC1E8.02 functions as a true ubiquitin-like modifier?

To determine if SPBC1E8.02 functions as a true ubiquitin-like modifier, design experiments that test for the hallmark characteristics of these proteins:

  • E1-E2-E3 enzyme cascade analysis:

    • Test for activation by known E1 enzymes (UBA1, UBA6) using in vitro thioester formation assays

    • Identify potential E2 enzymes through yeast two-hybrid screens or in vitro conjugation assays

    • Look for E3 ligase interactions using protein interaction studies

  • Conjugation assays:

    • Develop antibodies specific to SPBC1E8.02 to detect endogenous conjugates

    • Express tagged versions (His6-SPBC1E8.02) to purify conjugates under denaturing conditions

    • Use mass spectrometry to identify substrate proteins

  • Functional testing:

    • Test if SPBC1E8.02 competes with other ubiquitin-like modifiers for E1 activation, similar to how FAT10 interferes with SUMO activation

    • Examine if it affects protein stability, localization, or activity

These approaches will provide evidence for or against SPBC1E8.02 functioning as a canonical ubiquitin-like modifier versus having other roles.

What strategies should be employed for chromatin immunoprecipitation experiments involving SPBC1E8.02?

For chromatin immunoprecipitation (ChIP) experiments involving SPBC1E8.02, implement these methodological strategies:

  • Crosslinking optimization:

    • Test different formaldehyde concentrations (0.5-3%) and crosslinking times (5-30 minutes)

    • Consider dual crosslinking with disuccinimidyl glutarate followed by formaldehyde for protein-protein interactions

  • Antibody selection/validation:

    • Generate specific antibodies against SPBC1E8.02 or use epitope tags (FLAG, HA, or TAP)

    • Validate antibody specificity using knockout strains as negative controls

  • ChIP-seq implementation:

    • Follow the ChIP-on-chip methodology adapted for sequencing

    • Include appropriate controls (input DNA, IgG ChIP, untagged strain)

    • For S. pombe specifically, consider the challenges of its high AT-rich content in centromeric regions

  • Data analysis pipeline:

    • Use specialized peak calling algorithms suitable for histone modifications or transcription factors

    • Correlate SPBC1E8.02 binding sites with RNA Pol II occupancy patterns to determine potential regulatory roles

    • Compare binding profiles with known chromatin marks and transcription factors

This approach will enable the identification of genomic regions associated with SPBC1E8.02 and provide insights into its potential role in chromatin biology.

How can researchers effectively use quantitative proteomics to study SPBC1E8.02 interactions?

For effective quantitative proteomic analysis of SPBC1E8.02 interactions:

  • Sample preparation:

    • Generate strains expressing tagged SPBC1E8.02 (TAP-tag or BioID) under native promoter

    • Include appropriate controls (untagged strain, irrelevant protein tag)

    • For chromatin-bound interactions, adapt chromatin extraction protocols similar to those described by Wang

  • Analytical approach:

    • Implement SILAC (Stable Isotope Labeling with Amino acids in Cell culture) for quantitative comparison

    • Consider proximity-dependent biotin identification (BioID) for detecting transient interactions

    • Use Multiple Reaction Monitoring (MRM) for targeted quantification of specific interactions

  • Comparative analysis:

    • Compare SPBC1E8.02 interactome under different conditions (normal growth, stress, cell cycle stages)

    • Create interaction networks using statistical thresholds to distinguish true interactions

    • Validate key interactions through reciprocal IP, yeast two-hybrid, or FRET analysis

  • Data interpretation:

    • Categorize interacting proteins by cellular function and localization

    • Determine enrichment of interaction partners during specific physiological conditions

    • Identify potential substrates if SPBC1E8.02 functions as a modifier

This comprehensive approach will build a quantitative and condition-specific interaction map for SPBC1E8.02.

What techniques should be used to determine if SPBC1E8.02 is involved in the cell cycle regulation in S. pombe?

To determine if SPBC1E8.02 is involved in cell cycle regulation in S. pombe, implement these methodological approaches:

  • Cell cycle synchronization and expression analysis:

    • Synchronize cells using centrifugal elutriation or chemical blocks

    • Monitor SPBC1E8.02 expression, protein levels, and post-translational modifications throughout the cell cycle

    • Construct a strain with regulatable promoter to modulate SPBC1E8.02 levels

  • Cell cycle phenotype characterization:

    • Analyze Δspbc1e8.02 mutants for cell cycle defects (elongated cells, aberrant nuclei)

    • Perform FACS analysis to identify potential cell cycle stage accumulation

    • Use live-cell imaging with GFP-tagged SPBC1E8.02 to track localization changes through the cell cycle

  • Genetic interaction analysis:

    • Conduct synthetic genetic array (SGA) screening similar to the approach used for ell1, eaf1, and SPAC6G9.15c

    • Test for genetic interactions with known cell cycle regulators (cdc25, wee1, cdc2)

    • Construct double mutants with other ubiquitin-like modifiers to identify redundancy or antagonism

  • Molecular mechanism investigation:

    • Identify substrates modified during specific cell cycle phases using synchronized cells

    • Test if SPBC1E8.02 affects the stability of key cell cycle regulators

    • Examine effects on centromere structure or function using ChIP assays

These approaches systematically evaluate SPBC1E8.02's role in cell cycle regulation from multiple perspectives.

How can researchers determine if SPBC1E8.02 interacts with or modifies the SUMO pathway in S. pombe?

To investigate SPBC1E8.02's potential interaction with or modification of the SUMO pathway:

  • In vitro competition assays:

    • Test if SPBC1E8.02 competes with SUMO for activation by AOS1/UBA2 (E1), similar to how FAT10 interferes with SUMO activation

    • Measure thioester formation rates with varying concentrations of SPBC1E8.02 and SUMO

  • SUMO conjugation analysis:

    • Examine global SUMO conjugation patterns in Δspbc1e8.02 strains versus wild-type

    • Use quantitative proteomics to compare the SUMOylome in the presence/absence of SPBC1E8.02

    • Test if SPBC1E8.02 overexpression affects SUMO-dependent processes like PML body formation

  • Pathway component interactions:

    • Investigate direct interactions with SUMO pathway components (E1, E2, E3, SUMO proteases)

    • Test genetic interactions between SPBC1E8.02 and SUMO pathway genes

    • Examine co-localization patterns using fluorescently tagged proteins

  • Functional assessment:

    • Create a table comparing SUMO-dependent phenotypes in wild-type and SPBC1E8.02 mutant cells:

PhenotypeWild-typeΔspbc1e8.02SPBC1E8.02 overexpression
Global SUMOylationBaseline??
DNA damage responseNormal??
Chromosome segregationNormal??
Heat shock responseNormal??
Cell cycle progressionNormal??

These approaches will determine whether SPBC1E8.02 functions as a regulator of the SUMO pathway, similar to FAT10.

What approaches should be used to study the impact of environmental stress on SPBC1E8.02 expression and function?

To study how environmental stress affects SPBC1E8.02 expression and function:

  • Stress induction and expression analysis:

    • Expose S. pombe cultures to various stressors (oxidative, heat, osmotic, DNA damage)

    • Measure changes in SPBC1E8.02 mRNA levels using RT-qPCR

    • Monitor protein levels and post-translational modifications using western blotting

    • Implement time-course experiments to track expression dynamics during stress and recovery

  • Stress phenotype characterization:

    • Compare survival rates of wild-type and Δspbc1e8.02 strains under different stress conditions

    • Examine cellular morphology and localization changes of GFP-tagged SPBC1E8.02 during stress

    • Monitor global changes in the SPBC1E8.02 interactome and "modificome" during stress response

  • Transcriptomic analysis:

    • Perform RNA-seq comparing wild-type and Δspbc1e8.02 strains under normal and stress conditions

    • Create a stress-response gene expression signature for SPBC1E8.02 deletion

    • Identify transcription factors potentially regulated by SPBC1E8.02

  • Stress signaling pathway analysis:

    • Test if SPBC1E8.02 interacts with stress-activated protein kinases or transcription factors

    • Investigate if SPBC1E8.02 influences the activation of stress response pathways

    • Examine potential interactions with the Wsh3/Tea4 stress pathway scaffold that modulates polarized growth following osmotic stress

These methods will provide a comprehensive understanding of SPBC1E8.02's role in stress responses.

How can genome-wide genetic interaction screening be optimized for studying SPBC1E8.02 function?

To optimize genome-wide genetic interaction screening for SPBC1E8.02 function:

  • Screen design optimization:

    • Implement a synthetic genetic array (SGA) approach similar to that used for ell1, eaf1, and SPAC6G9.15c

    • Consider using quantitative fitness analysis rather than binary growth/no-growth scoring

    • Include conditional alleles of essential genes to expand the screen's coverage

    • Design the screen to detect both negative (synthetic sick/lethal) and positive (suppressor) interactions

  • Technical considerations:

    • Use robotics for high-throughput crosses and selection steps to minimize variability

    • Implement barcode-based parallel analysis for higher throughput and quantitative fitness measurements

    • Include multiple replicates and appropriate controls to establish statistical significance thresholds

  • Data analysis framework:

    • Generate genetic interaction profiles correlating SPBC1E8.02 with known biological processes

    • Cluster genetic interactions to identify functional groups

    • Create a hierarchical model of genetic interactions similar to:

Interaction strengthNumber of genesEnriched biological processesKey interactors
Strong negative???
Moderate negative???
No interaction???
Moderate positive???
Strong positive???
  • Validation strategy:

    • Confirm key interactions through manual tetrad dissection

    • Perform in-depth phenotypic analysis of double mutants showing strong interactions

    • Validate molecular mechanisms through biochemical approaches

This optimized approach will provide a comprehensive functional map of SPBC1E8.02 within the S. pombe genetic landscape.

What strategies should researchers employ to study potential roles of SPBC1E8.02 in chromatin regulation?

To investigate SPBC1E8.02's potential roles in chromatin regulation:

  • Chromatin association mapping:

    • Perform ChIP-seq to map genome-wide binding sites of SPBC1E8.02

    • Compare binding profiles with histone modifications, transcription factors, and chromatin remodelers

    • Use DamID as an alternative approach to validate ChIP-seq findings

    • Implement the quantitative proteomic approach described by Wang for analyzing chromatin-bound proteins

  • Chromatin state analysis:

    • Compare chromatin accessibility (ATAC-seq) between wild-type and Δspbc1e8.02 strains

    • Analyze changes in histone modification patterns using ChIP-seq

    • Examine effects on heterochromatin formation at centromeres, which are significantly larger (34-110 kb) in S. pombe than in S. cerevisiae

  • Transcriptional impact assessment:

    • Perform RNA-seq to identify genes differentially expressed in Δspbc1e8.02 strains

    • Use PRO-seq to measure nascent transcription and identify direct effects

    • Implement ChIP-seq for RNA Polymerase II to detect changes in transcriptional dynamics

  • Mechanistic investigation:

    • Test interactions with chromatin modifying enzymes and remodeling complexes

    • Investigate if SPBC1E8.02 directly modifies histones or chromatin factors

    • Examine potential roles in processes like transcription, DNA replication, or DNA repair

These approaches will provide comprehensive insights into SPBC1E8.02's potential functions in chromatin biology.

How should researchers design experiments to identify the enzymatic machinery associated with SPBC1E8.02 conjugation?

To identify the enzymatic machinery associated with SPBC1E8.02 conjugation:

  • E1 activating enzyme identification:

    • Test in vitro activation by known E1s (UBA1, UBA6) through ATP-PPi exchange assays

    • Perform thioester formation assays with recombinant SPBC1E8.02 and potential E1s

    • Investigate if SPBC1E8.02 competes with other ubiquitin-like modifiers for activation, similar to FAT10's interference with SUMO activation

  • E2 conjugating enzyme screening:

    • Conduct yeast two-hybrid screens using SPBC1E8.02 as bait against E2 libraries

    • Test thioester formation with potential E2s in vitro

    • Perform pulldown assays with tagged SPBC1E8.02 followed by western blotting for E2s

    • Create an E2 conjugating enzyme activity profile comparing SPBC1E8.02 with other ubiquitin-like proteins:

E2 enzymeUbiquitinSUMOSPBC1E8.02
UBC1+-?
UBC2+-?
UBC3+-?
UBC4+-?
UBC9-+?
  • E3 ligase identification:

    • Screen for interactions between SPBC1E8.02 and known E3 ligases

    • Perform in vitro conjugation assays with candidate E3s

    • Use proteomics to identify proteins that co-purify with tagged SPBC1E8.02

  • Deconjugating enzyme identification:

    • Test known deubiquitinating enzymes (DUBs) for activity against SPBC1E8.02 conjugates

    • Screen for genetic interactions between SPBC1E8.02 and DUB mutants

    • Identify proteases specific for SPBC1E8.02 using activity-based probes

This systematic approach will define the full enzymatic cascade required for SPBC1E8.02 function as a protein modifier.

How can researchers effectively compare SPBC1E8.02 function between S. pombe and S. cerevisiae or other model organisms?

To effectively compare SPBC1E8.02 function across species:

  • Sequence and structural comparison:

    • Perform phylogenetic analysis to identify orthologs in S. cerevisiae and other organisms

    • Compare protein domain architectures to identify conserved and divergent features

    • Use structural prediction tools to model and compare three-dimensional structures

  • Complementation studies:

    • Express SPBC1E8.02 in S. cerevisiae orthologs' deletion strains to test functional conservation

    • Introduce orthologs from other species into Δspbc1e8.02 S. pombe to assess rescue capacity

    • Analyze domain-swapping chimeras to identify functionally crucial regions

  • Comparative phenotypic analysis:

    • Create a table comparing phenotypes of ortholog deletions across species:

PhenotypeS. pombe Δspbc1e8.02S. cerevisiae ΔorthologHuman cells (siRNA knockdown)
Growth rate???
Cell cycle effects???
Stress response???
Protein homeostasis???
  • Molecular function comparison:

    • Compare interaction networks across species using orthologous proteins

    • Examine conservation of substrate specificity if SPBC1E8.02 functions as a modifier

    • Investigate if regulatory mechanisms are conserved across species

This comparative approach leverages evolutionary relationships to gain insight into conserved functions and species-specific adaptations of SPBC1E8.02.

What considerations should researchers take into account when designing diversity and inclusion practices for collaborative research on SPBC1E8.02?

When designing diversity and inclusion practices for collaborative research on SPBC1E8.02:

  • Team composition and dynamics:

    • Assemble diverse research teams considering gender, ethnicity, career stage, and disciplinary backgrounds

    • Implement practices that ensure equitable contribution and acknowledgment from all team members

    • Create an inclusive environment that values different perspectives and approaches to scientific problems

    • Consider research showing that diverse teams report better communication and greater satisfaction with research processes

  • Methodological considerations:

    • Design experiments that acknowledge potential biases in traditional research approaches

    • Ensure protocols are accessible and implementable across different resource settings

    • Consider multiple theoretical frameworks for interpreting results

    • Include team members with complementary expertise in protein biochemistry, genetics, and computational biology

  • Knowledge sharing and access:

    • Develop accessible documentation and protocols to facilitate broader participation

    • Share reagents, strains, and tools with researchers from institutions with fewer resources

    • Consider open science practices including pre-registration of studies and data sharing

    • Publish in both open access and traditional journals to maximize accessibility

  • Community engagement:

    • Engage with the broader S. pombe research community to share resources and knowledge

    • Develop training opportunities for researchers from underrepresented groups

    • Consider the power dynamics between researchers and research communities

    • Acknowledge all contributions to the research, including technical support staff

How should researchers approach the integration of computational and experimental methods in the comprehensive characterization of SPBC1E8.02?

For integrating computational and experimental approaches to characterize SPBC1E8.02:

  • Iterative analysis workflow:

    • Begin with computational predictions (structure, function, interactions) to guide initial experiments

    • Use experimental results to refine computational models in an iterative cycle

    • Implement a data integration platform that combines results from multiple approaches

    • Develop a structured workflow similar to:

StageComputational approachExperimental validationIntegration method
Initial characterizationHomology modeling, sequence analysisExpression verification, localizationFeature confirmation
Functional predictionInteraction network prediction, domain analysisY2H screens, co-IPNetwork enrichment
Mechanism elucidationMolecular dynamics simulationsMutational analysis, in vitro assaysStructural validation
Systems-level understandingPathway modeling, genetic interaction predictionGenetic screens, global -omicsPathway mapping
  • Machine learning implementation:

    • Train prediction models using known ubiquitin-like modifiers to identify potential substrates

    • Validate predictions experimentally to improve model accuracy

    • Use active learning approaches to prioritize experiments with highest information content

  • Data management considerations:

    • Implement FAIR (Findable, Accessible, Interoperable, Reusable) data principles

    • Develop standardized data formats that capture both computational and experimental results

    • Create visualization tools that integrate multiple data types

  • Interdisciplinary collaboration structure:

    • Form teams with both wet-lab and computational expertise

    • Establish common language and regular communication channels

    • Develop shared project milestones that require input from both approaches

    • Include researchers with diverse disciplinary backgrounds to maximize the "edge effect" where different knowledge bases interact

This integrated approach leverages the strengths of both computational and experimental methods while minimizing their individual limitations.

What are the most promising future research directions for understanding SPBC1E8.02 function?

The most promising future research directions for understanding SPBC1E8.02 function include:

  • Systems biology approach:

    • Create a comprehensive genetic and protein interaction map for SPBC1E8.02

    • Develop mathematical models of SPBC1E8.02 function within cellular networks

    • Integrate multiple -omics datasets to understand its role at the systems level

  • Evolutionary functional analysis:

    • Conduct comparative studies across diverse fungal species to trace functional evolution

    • Identify conserved interaction partners across evolutionary distance

    • Investigate how SPBC1E8.02 function may have diverged from other ubiquitin-like proteins

  • Structure-function relationships:

    • Determine the three-dimensional structure of SPBC1E8.02 using X-ray crystallography or cryo-EM

    • Map functional domains through mutational analysis

    • Design structure-based experiments to understand substrate recognition

  • Physiological role clarification:

    • Investigate SPBC1E8.02 function under different growth conditions and stresses

    • Examine its role in specialized cellular processes like meiosis or quiescence

    • Study potential roles in protein quality control and homeostasis

These directions will contribute to understanding not only SPBC1E8.02 specifically but also broaden our knowledge of ubiquitin-like proteins and their diverse functions in eukaryotic cells.

How can researchers contribute SPBC1E8.02 data to community resources and nomenclature standardization?

To contribute SPBC1E8.02 data to community resources and standardize nomenclature:

  • Data submission guidelines:

    • Submit sequence data to GenBank/ENA/DDBJ with complete annotation

    • Deposit structural data in the Protein Data Bank with detailed metadata

    • Share proteomic datasets via ProteomeXchange repositories

    • Contribute genetic interaction data to BioGRID or similar databases

  • Nomenclature standardization:

    • Follow the International Protein Nomenclature Guidelines when naming protein isoforms or domains

    • Use American spelling consistently in publications and database submissions

    • If a specific function is discovered, propose a systematic name to the S. pombe research community

    • Avoid creating new abbreviations; instead, use established nomenclature for post-translational modifications

  • Resource development:

    • Contribute data to PomBase, the model organism database for S. pombe

    • Develop and share protocols via repositories like protocols.io

    • Create open-source analytical tools for specific aspects of SPBC1E8.02 research

    • Contribute to community-curated wikis and knowledge bases

  • Collaborative framework:

    • Participate in community-wide efforts to standardize experimental approaches

    • Engage with nomenclature committees to propose function-based naming if appropriate

    • Share reagents through repositories like Addgene or directly with other researchers

    • Participate in collaborative research networks focused on ubiquitin-like proteins

These contributions will enhance the accessibility and utility of SPBC1E8.02 research for the broader scientific community.

What experimental design considerations are most critical for ensuring reproducibility in SPBC1E8.02 research?

To ensure reproducibility in SPBC1E8.02 research:

  • Strain and reagent standardization:

    • Deposit strains in community repositories with complete genotype information

    • Verify strain identities through genotyping before key experiments

    • Use consistent growth conditions and media formulations across experiments

    • Include detailed methodology for recombinant protein production including expression systems, tags, and purification protocols

  • Experimental design principles:

    • Follow the five key steps of experimental design outlined in search result :

      • Define variables and how they are related

      • Write specific, testable hypotheses

      • Design experimental treatments to manipulate independent variables

      • Assign subjects to groups appropriately

      • Plan precise measurements of dependent variables

    • Include positive and negative controls in all experiments

    • Determine appropriate sample sizes through power analysis

    • Implement randomization and blinding where appropriate

  • Data collection and analysis transparency:

    • Pre-register experimental designs and analysis plans when possible

    • Report all exclusion criteria and outliers

    • Share raw data alongside publications

    • Document complete computational workflows and code

    • Provide detailed statistical analysis methods including specific tests and corrections

  • Validation requirements:

    • Confirm key findings using multiple independent methods

    • Validate antibody specificity using appropriate controls (e.g., knockout strains)

    • Replicate critical experiments in independent laboratories when possible

    • Test reproducibility across different S. pombe strain backgrounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.