Recombinant Schizosaccharomyces pombe UPF0041 protein C1235.11 (SPCC1235.11)

What is Recombinant Schizosaccharomyces pombe UPF0041 protein C1235.11?

Recombinant Schizosaccharomyces pombe UPF0041 protein C1235.11 (SPCC1235.11) is a full-length protein (141 amino acids) also known as MPC1 (Mitochondrial Pyruvate Carrier 1). The protein is typically produced as a recombinant construct with an N-terminal His-tag expressed in E. coli expression systems. The complete amino acid sequence is: MNASEKLSQKAAQSVTRRFITWLKSPDFRKYLCSTHFWGPLSNFGIPIAAILDLKKDPRLISGRMTGALILYSSVFMRYAWMVSPRNYLLLGCHAFNTTVQTAQGIRFVNFWYGKEGASKQSVFENIMQAAKHPESGTRQK .

What are the optimal storage conditions for maintaining protein stability?

To maintain stability and activity of the recombinant protein, store the lyophilized powder at -20°C to -80°C upon receipt. After reconstitution, working aliquots can be kept at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being standard) and store aliquots at -20°C or -80°C . This approach helps prevent structural damage from ice crystal formation during freeze-thaw cycles.

How should the protein be reconstituted for experimental use?

The recommended reconstitution protocol involves:

• Brief centrifugation of the vial before opening to bring contents to the bottom

• Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Addition of glycerol to 5-50% final concentration for samples intended for long-term storage

• Gentle mixing without vigorous shaking to prevent protein denaturation

The protein is supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during the lyophilization process .

How can I design experiments to study MPC1 function in S. pombe?

When designing experiments to study MPC1 function in S. pombe, follow these methodological steps:

• Hypothesis formulation: Based on MPC1's predicted role as a mitochondrial pyruvate carrier, formulate testable hypotheses about its function in cellular metabolism.

• Control selection: Include appropriate controls in your experimental design:

  • Wild-type S. pombe strains

  • MPC1 knockout strains

  • Strains expressing mutant versions of MPC1

• Variable isolation: Follow the experimental method principle of isolating causes by manipulating a single variable at a time while keeping others constant2.

• Phenotypic assessment: Measure growth rates, mitochondrial function, and metabolic profiles under different conditions (e.g., carbon sources, stress conditions).

• Validation: Confirm findings through complementation studies using the recombinant protein to rescue knockout phenotypes.

What techniques are recommended for studying protein-protein interactions involving MPC1?

Several techniques can be employed to study protein-protein interactions involving MPC1:

Basic approaches:

• Co-immunoprecipitation using the His-tag

• Yeast two-hybrid screening

• Proximity labeling methods

Advanced approaches:

• Chromatin immunoprecipitation (ChIP) when studying potential chromatin associations

• Mass spectrometry following pull-down experiments

• Fluorescence resonance energy transfer (FRET) with fluorescently tagged MPC1

For ChIP experiments, consider using antibodies against the His-tag or specific MPC1 epitopes. The approach used for histone modification studies in S. pombe can be adapted, where ChIP DNA is labeled with fluorescent dyes (Cy3/Cy5) and hybridized to microarrays . This methodology allows for genome-wide mapping of protein interactions and has been successfully applied in S. pombe with correlation coefficients of 0.8-0.9 between replicate experiments .

How can genome-wide approaches be utilized to study MPC1 function in S. pombe?

Genome-wide approaches offer powerful tools for understanding MPC1 function within the broader cellular context:

• Expression profiling: Compare gene expression between wild-type and MPC1 mutant strains using cDNA microarrays or RNA-seq. This reveals genes that are differentially expressed when MPC1 function is altered.

• ChIP-seq analysis: If MPC1 has potential chromatin associations, perform ChIP-seq using tagged MPC1 to identify genomic binding sites. This approach has been successfully used for other proteins in S. pombe with high statistical significance (P-values as low as 2.95E-240 for overlapping binding sites) .

• Chromatin structure analysis: Investigate if MPC1 affects nucleosome density or histone modifications using methods similar to those described for histone H3 C-terminal region (H3 cter) antibody studies .

• Metabolomic profiling: Combine genomic approaches with metabolomic analysis to correlate gene expression changes with metabolic alterations in MPC1 mutants.

• Statistical analysis: Apply hypergeometric distribution tests to identify significant overlaps between different datasets, as demonstrated in previous S. pombe studies where P-values of 2.1E-4 indicated significant associations .

What approaches can resolve contradictions in experimental data regarding MPC1 function?

When facing contradictory experimental results regarding MPC1 function, consider these methodological approaches:

• Strain background verification: Ensure experiments use isogenic strains to eliminate genetic background as a variable. In S. pombe studies, backcrossing mutant alleles with standard laboratory strains (e.g., 972 h-) has been used to ensure isogenic backgrounds .

• Growth condition standardization: Standardize growth conditions (medium composition, growth phase, cell density) across experiments. Previous studies show that different growth media (minimal vs. YES medium) can affect experimental outcomes while still maintaining significant overlaps in results (P = 2.82E-108) .

• Validation with multiple techniques: Confirm findings using orthogonal methods:

  • Genetic: Gene deletion, point mutations, complementation

  • Biochemical: In vitro activity assays, structural studies

  • Cellular: Localization, interaction studies

• Control for technical variability: Implement technical controls such as dye-swap in microarray experiments to address potential biases. Previous S. pombe studies achieved correlation coefficients of 0.8-0.9 using such controls .

• Meta-analysis: Integrate data from multiple experiments using statistical methods to identify consistent patterns despite variations in individual experiments.

What are common pitfalls when working with recombinant S. pombe proteins and how can they be addressed?

Common challenges when working with recombinant S. pombe proteins include:

• Protein solubility issues:

  • Challenge: The recombinant protein may form inclusion bodies or aggregate.

  • Solution: Optimize expression conditions (temperature, IPTG concentration), use solubility tags, or explore alternative expression systems.

• Protein activity loss:

  • Challenge: Loss of functional activity during purification or storage.

  • Solution: Add stabilizing agents like trehalose (as included in the storage buffer at 6%) , avoid repeated freeze-thaw cycles, and store aliquots at appropriate temperatures.

• Contamination with host proteins:

  • Challenge: Co-purification of E. coli proteins with the target.

  • Solution: Implement additional purification steps, optimize imidazole concentrations during His-tag purification, or consider orthogonal purification strategies.

• Post-translational modification differences:

  • Challenge: E. coli-expressed proteins lack eukaryotic modifications present in native S. pombe.

  • Solution: Consider eukaryotic expression systems for studies where post-translational modifications are critical.

• Experimental reproducibility:

  • Challenge: Variability between protein batches.

  • Solution: Establish quality control metrics for each batch, including purity assessment (>90% by SDS-PAGE) and activity assays.

How can the recombinant protein be effectively used in functional complementation studies?

To effectively use recombinant MPC1 protein in functional complementation studies:

• Delivery method selection:

  • For in vitro studies: Direct addition to permeabilized cells or isolated mitochondria

  • For in vivo studies: Consider protein transfection reagents or expression constructs

• Concentration optimization:

  • Perform dose-response experiments to determine effective protein concentrations

  • Begin with concentrations in the range of 0.1-1.0 mg/mL as recommended for reconstitution

• Functional readouts:

  • Establish clear metrics for successful complementation

  • Consider metabolic assays focused on pyruvate metabolism

  • Measure mitochondrial function parameters (membrane potential, respiration)

• Positive and negative controls:

  • Include wild-type protein as positive control

  • Use denatured protein or buffer-only treatments as negative controls

  • Consider partial function mutants as intermediate controls

• Verification of protein internalization:

  • Use fluorescently labeled protein to track cellular uptake

  • Perform subcellular fractionation to confirm mitochondrial localization

How does MPC1 function in S. pombe compare with its homologs in other species?

Understanding the evolutionary conservation and divergence of MPC1 function requires comparative analysis:

• Sequence conservation analysis:

  • Align S. pombe MPC1 (141 aa) with homologs from other species

  • Identify conserved domains and species-specific variations

  • Map functional motifs to the 3D structure if available

• Functional complementation across species:

  • Test if MPC1 from other species (human, mouse, rat, chicken, bovine) can complement S. pombe MPC1 deletion

  • Commercial availability of MPC1 from multiple species facilitates these studies

• Expression pattern comparison:

  • Compare tissue/condition-specific expression patterns between species

  • Identify conserved and divergent regulatory mechanisms

• Protein interaction network analysis:

  • Compare MPC1 interaction partners across species

  • Identify conserved core interactions versus species-specific ones

What novel experimental approaches could advance our understanding of MPC1 function?

Several cutting-edge approaches could significantly advance MPC1 research:

• CRISPR-based techniques:

  • Generate precise point mutations to map functional domains

  • Create conditional knockouts to study temporal aspects of MPC1 function

  • Implement CRISPRi/CRISPRa for tunable expression control

• Single-cell analysis:

  • Investigate cell-to-cell variability in MPC1 expression and function

  • Combine with metabolic profiling to correlate MPC1 levels with metabolic states

• Structural biology approaches:

  • Determine the 3D structure of S. pombe MPC1 using crystallography or cryo-EM

  • Study conformational changes during substrate transport

  • Perform in silico docking studies to predict interactions with small molecules

• Systems biology integration:

  • Construct comprehensive models incorporating transcriptomic, proteomic, and metabolomic data

  • Predict system-wide effects of MPC1 perturbation

  • Validate model predictions with targeted experiments

• Live-cell imaging techniques:

  • Track MPC1 dynamics in living cells using fluorescent protein fusions

  • Measure mitochondrial pyruvate transport in real-time

  • Correlate MPC1 localization with mitochondrial function parameters