Recombinant Schizosaccharomyces pombe UPF0136 membrane protein P14E8.05c (SPAP14E8.05c)

What is Schizosaccharomyces pombe UPF0136 membrane protein P14E8.05c?

Schizosaccharomyces pombe UPF0136 membrane protein P14E8.05c is a 101-amino acid transmembrane protein found in fission yeast (S. pombe strain 972 / ATCC 24843). The full amino acid sequence is: MTPDQNALVLSFLLTVGGLIGYLRKKSKVSLIAGTALGANFAWASKLMERGSSQGINYAFYGSLVLLASSGPRFYKSRKPVPMILTVLGVISTWYFYRLWA. The protein is classified as part of the UPF0136 protein family and is identified by UniProt accession number Q9P7G3 . As a membrane protein, it is likely involved in cellular processes related to membrane function, though its specific biological role remains to be fully characterized through targeted experimental approaches.

What are the optimal storage conditions for recombinant SPAP14E8.05c?

For recombinant SPAP14E8.05c, the recommended storage conditions are -20°C for standard use, with -80°C recommended for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized for protein stability. When working with this protein, it is advisable to prepare working aliquots stored at 4°C that can be used for up to one week. Repeated freeze-thaw cycles should be strictly avoided as they can compromise protein integrity and activity . This approach minimizes structural degradation while maintaining functional properties for experimental applications.

How should experimental replicates be designed when working with this protein?

When designing experiments with recombinant SPAP14E8.05c, proper replication serves multiple critical functions: providing estimates of experimental error, improving precision by reducing standard deviation of treatment means, and increasing the scope of inference. Distinguish between true biological replicates (independent experimental units treated identically) and technical subsamples (multiple measurements from the same experimental unit) .

For membrane protein studies, a minimum of three biological replicates is recommended, with increased replication necessary when exploring subtle phenotypic effects. The relative precision of different experimental designs can be calculated as:

Relative efficiency = (MSE₂/MSE₁) × (dfe₁/dfe₂)

Where MSE represents error mean square and dfe represents error degrees of freedom for the respective designs . This calculation helps determine the most efficient experimental approach while minimizing resource usage.

How can SPAP14E8.05c be utilized in S-phase checkpoint studies?

S. pombe has a well-characterized S-phase DNA damage checkpoint that is dependent on proteins like Rad3 (homolog to mammalian ATM/ATR) and Cds1 . To investigate potential roles of SPAP14E8.05c in this pathway, researchers should implement a systematic experimental approach:

• Generate SPAP14E8.05c deletion or mutation strains using standard S. pombe genetic techniques

• Subject wild-type and mutant cells to DNA damaging agents (UV irradiation at 254nm)

• Monitor checkpoint activation through:

  • Flow cytometry to assess cell cycle progression

  • Western blot analysis of Cds1 phosphorylation status

  • Microscopy to examine nuclear morphology

The experimental design should include appropriate controls that discriminate between different types of DNA damage responses. This is particularly important since S. pombe exhibits differential responses to UV-irradiation (which causes base modifications repairable during G1 and S-phase) versus gamma-irradiation (which causes double-stranded breaks) .

What methods are appropriate for studying SPAP14E8.05c's potential role in meiotic recombination?

To investigate SPAP14E8.05c's involvement in meiotic recombination, implement established S. pombe genetic assays that measure:

For intragenic recombination measurement, plate diluted spores on both selective and non-selective media (e.g., YEA for total viable spores and YEA+G for Ade+ spores). Calculate recombination frequency by dividing the concentration of selected recombinants by the concentration of total viable spores . This approach provides quantitative data on how SPAP14E8.05c influences meiotic recombination rates, which can be compared with known recombination pathway components.

How might SPAP14E8.05c interact with replication fork barriers?

Recent research indicates proteins like Rtf2 in S. pombe are important for replication fork stability and interact with mRNA processing factors . To investigate potential interactions between SPAP14E8.05c and replication fork processes:

• Create double mutants with known replication barrier components (e.g., rtf1 and rtf2)

• Employ 2D gel electrophoresis to visualize replication intermediates at known barrier sites

• Assess genetic interactions through phenotypic analysis of single vs. double mutants

• Perform co-immunoprecipitation studies to identify potential physical interactions with known barrier proteins

This approach would determine whether SPAP14E8.05c influences replication barrier activity, possibly through direct interactions or through effects on splicing of critical replication factors like rtf1, as has been demonstrated for Rtf2 .

What protein-protein interaction methods are most suitable for membrane proteins like SPAP14E8.05c?

Investigating protein-protein interactions for membrane proteins presents unique challenges due to their hydrophobicity and native lipid environment requirements. A multi-method approach is recommended:

When designing these experiments, include appropriate controls with mutations in key domains of SPAP14E8.05c to distinguish specific from non-specific interactions. Verification across multiple methods significantly strengthens confidence in identified interaction partners.

How should researchers address missing data in experiments with SPAP14E8.05c?

Missing data in experiments with membrane proteins like SPAP14E8.05c can introduce significant bias. Implement the following systematic approach:

• Document patterns of missingness through a comprehensive Table 1 that compares variables between complete and partial cases

• Assess whether outcomes are associated with missingness patterns

• Implement appropriate analytical strategies:

  • For data missing completely at random (MCAR): complete case analysis may be appropriate

  • For data missing at random (MAR): multiple imputation techniques

  • For data not missing at random (MNAR): sensitivity analyses with different assumptions

What statistical approaches are most appropriate for analyzing subcellular localization data of SPAP14E8.05c?

Analyzing subcellular localization data for membrane proteins requires specialized statistical approaches:

• Implement quantitative image analysis rather than qualitative assessment

• Use colocalization coefficients (Pearson's, Mander's) with appropriate statistical tests

• For time-series localization studies, employ mixed-effects models that account for:

  • Fixed effects (experimental conditions)

  • Random effects (cell-to-cell variability)

  • Temporal autocorrelation

When reporting results, present both representative images and quantitative metrics with measures of uncertainty. Test for the normality of distribution in quantitative measures before applying parametric statistical tests, and consider non-parametric alternatives when assumptions are violated. This comprehensive approach provides robust evidence for SPAP14E8.05c localization patterns under various experimental conditions.

How should control groups be structured in SPAP14E8.05c knockout studies?

When designing knockout studies for SPAP14E8.05c, implement a multi-level control structure:

• Wild-type controls (unmodified S. pombe)

• Empty vector controls (for complementation studies)

• Point mutant controls (with mutations in key functional domains)

• Related gene knockouts (other UPF family proteins)

This nested control design allows discrimination between specific effects of SPAP14E8.05c loss versus general perturbations to membrane integrity or related pathways. Incorporate randomization in the experimental design to ensure that observed phenotypic differences are not confounded by external factors like culture conditions or measurement protocols . Document all control validation steps in supplementary materials to enhance reproducibility.

What are the most effective strategies for validating antibodies against SPAP14E8.05c?

Antibody validation is critical for reliable detection of SPAP14E8.05c. Implement these methodological approaches:

• Specificity validation:

  • Western blot comparing wild-type vs. knockout strains

  • Peptide competition assays

  • Orthogonal detection methods (mass spectrometry)

• Sensitivity assessment:

  • Titration experiments with recombinant protein standards

  • Detection limit determination

  • Signal-to-noise ratio quantification

• Reproducibility testing:

  • Intra-lab reproducibility (multiple experiments)

  • Inter-lab validation when possible

  • Batch-to-batch antibody variation assessment

Document all validation steps according to emerging minimum reporting standards for antibody validation in the scientific literature. This rigorous approach prevents misinterpretation of data due to antibody cross-reactivity or insufficient sensitivity.

How can researchers optimize expression of SPAP14E8.05c for structural studies?

Structural studies of membrane proteins require significant quantities of properly folded protein. Optimize expression using this systematic approach:

• Expression system selection:

  • E. coli with specialized strains (C41/C43) for membrane proteins

  • Yeast systems (P. pastoris) for eukaryotic post-translational modifications

  • Cell-free systems for toxic proteins

• Expression construct optimization:

  • Test multiple fusion tags (His, GST, MBP) at N- and C-termini

  • Include removable tags with specific protease sites

  • Consider codon optimization for expression host

• Solubilization and purification strategy:

  • Screen detergent panels (DDM, LMNG, etc.)

  • Test nanodiscs or amphipols for detergent-free approaches

  • Implement multi-step purification with quality control at each step

Document protein yield, purity, and stability under different conditions to establish optimal protocols. The purified protein should be stored in buffer containing 50% glycerol at -20°C or -80°C for extended storage, with working aliquots maintained at 4°C for up to one week .

How should researchers resolve contradictory results regarding SPAP14E8.05c function?

When faced with contradictory experimental results concerning SPAP14E8.05c function, implement this systematic resolution framework:

• Methodological reconciliation:

  • Compare experimental conditions in detail (strain backgrounds, media, temperature)

  • Assess differences in measurement techniques and their sensitivities

  • Evaluate statistical approaches and sample sizes

• Biological context analysis:

  • Consider genetic background differences that might reveal condition-specific functions

  • Examine potential redundancy with related proteins

  • Investigate environmental factors that might affect protein function

• Hypothesis refinement:

  • Develop integrative models that accommodate seemingly contradictory observations

  • Design discriminating experiments that test competing hypotheses

  • Consider partial or context-dependent functions

This approach transforms contradictions into opportunities for deeper mechanistic understanding, potentially revealing condition-specific roles for SPAP14E8.05c that reconcile apparently conflicting observations.

What criteria should be used to evaluate the quality of recombinant SPAP14E8.05c preparations?

Implement these quality control criteria for recombinant SPAP14E8.05c preparations:

Batch-to-batch consistency should be documented through comparative analysis of these parameters. For membrane proteins, additional criteria include proper incorporation into liposomes or nanodiscs and appropriate orientation within these membrane mimetics.

How can researchers distinguish between direct and indirect effects of SPAP14E8.05c mutations?

Distinguishing direct from indirect effects of SPAP14E8.05c mutations requires a multi-faceted approach:

• Temporal analysis:

  • Monitor phenotypes at multiple time points after perturbation

  • Use rapid induction/depletion systems to establish immediate versus delayed effects

• Domain-specific mutations:

  • Create targeted mutations in functional domains rather than complete gene deletions

  • Implement structure-function analysis with point mutations targeting key residues

• Rescue experiments:

  • Perform complementation with wild-type and mutant versions

  • Use orthologous proteins from related species to identify conserved functions

• Direct interaction assessment:

  • Implement proximity labeling approaches to identify direct interaction partners

  • Perform in vitro binding studies with purified components

This systematic approach helps establish causality and delineate the direct functional roles of SPAP14E8.05c from secondary effects resulting from cellular adaptations to its absence.