Recombinant Schizosaccharomyces pombe UPF0382 membrane protein C1782.12c (SPAC1782.12c)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Nomenclature

  • Uniprot ID: Q9P7G8 .

  • Gene Name: SPAC1782.12c .

  • Protein Names: UPF0382 membrane protein C1782.12c .

  • Family/Class: Uncharacterized membrane protein with no annotated functional domains in public databases .

Key Attributes

AttributeDescription
Source OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843) .
Protein LengthFull-length sequence (19–118 amino acids) .
Expression SystemE. coli (N-terminal 10xHis-tagged) .
Storage BufferTris-based buffer with 50% glycerol .
Purity/FormatRecombinant protein in solution (50 µg vials) .

Production and Purification

The protein is produced via recombinant expression in E. coli, followed by purification under optimized conditions . Key steps include:

  • Cloning: Insertion of the SPAC1782.12c coding sequence into a bacterial expression vector.

  • Expression: Induction of protein synthesis in E. coli cultures.

  • Purification: Affinity chromatography (e.g., His-tag purification) to isolate the protein .

  • Quality Control: Verification of protein identity via SDS-PAGE or mass spectrometry (not explicitly stated in sources).

Biochemical and Functional Insights

While functional studies are absent in the provided sources, the protein’s membrane localization suggests potential roles in:

  • Membrane Transport: Hypothesized based on its classification as a transmembrane protein .

  • Signal Transduction: Possible involvement in cellular signaling pathways, though unverified.

Applications in Research and Industry

The recombinant protein is marketed as a tool for:

  • Antibody Production: Generating specific antibodies for immunoblotting or immunoprecipitation.

  • Protein-Protein Interaction Studies: Investigating binding partners in S. pombe or heterologous systems.

  • Structural Biology: Crystallization or NMR studies to elucidate its 3D structure .

Limitations and Research Gaps

  • Functional Annotation: No peer-reviewed studies describe its biological role or biochemical activity.

  • Conservation: Limited homology to characterized proteins in other organisms .

  • Commercial Focus: Data primarily derive from product catalogs rather than experimental publications.

Future Directions

To advance understanding, researchers could:

  1. Perform Functional Screens: Use CRISPR knockouts or RNAi to assess phenotypic effects in S. pombe.

  2. Conduct Interaction Mapping: Identify binding partners via mass spectrometry or two-hybrid assays.

  3. Structural Characterization: Solve its crystal structure to predict functional motifs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPAC1782.12c; UPF0382 membrane protein C1782.12c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-118
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC1782.12c
Target Protein Sequence
AYGSHGLQKRVQDPHLLKSWSTACTYLMFHSLATMAVSLHPVYGKSRWTGPLLITGSCLF SGTIYGLCLLPKGHSLRRILGPLTPIGGLVMLTGWATMLV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0382 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant SPAC1782.12c?

E. coli has been successfully used as the primary expression system for recombinant SPAC1782.12c. The following table summarizes the established expression parameters:

ParameterDetails
Host SystemE. coli
Protein LengthFull Length (Mature Protein: 19-118 aa)
TagHis-tag
VectorExpression vectors with T7 or similar promoters
Species SourceSchizosaccharomyces pombe

For optimal expression, researchers should consider using specialized E. coli strains designed for membrane protein expression such as C41(DE3) or C43(DE3).

How is SPAC1782.12c distributed within cellular compartments?

As a membrane protein, SPAC1782.12c is expected to localize to cellular membranes, though specific localization studies are not extensively documented in the provided literature. Researchers investigating localization should consider multiple complementary approaches:

  • Fluorescent protein tagging (GFP fusion constructs)

  • Subcellular fractionation followed by Western blot analysis

  • Immunofluorescence with antibodies specific to SPAC1782.12c or its tag

  • Protease protection assays to determine membrane topology

When designing localization experiments, consider that membrane protein overexpression can sometimes lead to mislocalization artifacts.

What purification strategy should be used for recombinant His-tagged SPAC1782.12c?

Purifying membrane proteins requires specialized approaches. For His-tagged SPAC1782.12c, researchers should implement a multi-step protocol:

  • Cell lysis optimization: Sonication or high-pressure homogenization in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Solubilization screening with detergents suitable for membrane proteins (DDM, LDAO, or Triton X-100)

  • IMAC purification using Ni-NTA resin with optimized imidazole concentrations

  • Size exclusion chromatography for final polishing and detergent exchange

Critical quality control steps include SDS-PAGE with Coomassie staining and Western blotting to confirm target protein identity and purity.

How should researchers approach investigating potential interaction partners of SPAC1782.12c?

Investigating protein-protein interactions for membrane proteins presents unique challenges. For SPAC1782.12c, consider these methodological approaches:

  • Proximity-based labeling techniques such as BioID or TurboID (as demonstrated for Rtf2 in S. pombe)

  • Co-immunoprecipitation with crosslinking to stabilize transient interactions

  • Yeast two-hybrid adapted for membrane proteins (split-ubiquitin system)

  • Mass spectrometry analysis of protein complexes after gentle solubilization

When analyzing potential interactions, researchers should be mindful that the artificial expression environment might influence interaction patterns compared to native conditions.

What are the most effective methods for studying the function of SPAC1782.12c?

To elucidate the function of this largely uncharacterized protein, researchers should consider a multi-faceted approach:

  • Gene deletion/knockout studies in S. pombe to identify phenotypic changes

  • Conditional expression systems to study essential functions

  • Point mutations of conserved residues to identify functionally important domains

  • Transcriptomic analysis to identify genes differentially expressed in knockout strains

  • Stress response assays to detect condition-specific functions (similar to approaches used in other S. pombe studies)

For RNA-based studies, methods similar to those described for S. pombe stress response research can be adapted, including RNA extraction, labeling, and microarray or RNA-seq analysis with appropriate normalization methods .

How can researchers determine if SPAC1782.12c is involved in specific cellular pathways?

To investigate pathway involvement, researchers should implement systematic approaches:

  • Compare growth phenotypes of SPAC1782.12c deletion strains under various stress conditions

  • Analyze genetic interactions through synthetic lethality/sickness screens

  • Perform phosphoproteomic analysis to identify post-translational modifications

  • Use chromatin immunoprecipitation (ChIP) if transcriptional regulation is suspected

  • Apply metabolomic profiling to detect changes in cellular metabolism

When interpreting results, consider that redundant pathways may mask phenotypes, necessitating double or triple mutation studies.

What considerations are important when designing experiments to study potential roles of SPAC1782.12c in membrane dynamics?

Membrane proteins often contribute to membrane organization, dynamics, or transport functions. When investigating these aspects:

  • Use fluorescence recovery after photobleaching (FRAP) to study protein mobility

  • Employ lipid-binding assays to determine specific lipid interactions

  • Consider reconstitution in liposomes to study transport or channel activity

  • Use electron microscopy to examine membrane morphology in deletion strains

  • Apply super-resolution microscopy to visualize nanoscale membrane domains

Each method requires careful optimization for membrane proteins, with particular attention to maintaining native membrane environments.

How should researchers interpret contradictory findings about SPAC1782.12c function?

When faced with inconsistent results:

  • Examine strain background differences that might explain phenotypic variations

  • Consider post-translational modifications that might differ between experimental conditions

  • Verify antibody specificity if immunological methods were used

  • Evaluate whether different tags might interfere with protein function differently

  • Assess whether experimental conditions (temperature, media, growth phase) might explain discrepancies

Document methodological details thoroughly to enable accurate comparison between studies and facilitate reproducibility.

What statistical approaches are most appropriate for analyzing SPAC1782.12c expression or functional data?

Researchers should select statistical methods based on experimental design:

  • For comparison of expression levels: t-tests with appropriate corrections for multiple testing

  • For time-course experiments: repeated measures ANOVA or mixed-effects models

  • For high-throughput data: normalization protocols as described for microarray analysis of S. pombe

  • For motif discovery in regulatory regions: statistical overrepresentation analysis similar to methods used for stress-response genes

When using tools like SPEXS for sequence motif analysis, researchers should apply statistical significance calculations according to binomial distribution and establish clear thresholds as described in S. pombe transcriptional response studies .

How can researchers effectively integrate data from multiple experimental approaches to build a comprehensive model of SPAC1782.12c function?

Data integration strategies include:

  • Hierarchical clustering of expression data to identify co-regulated genes

  • Network analysis of protein-protein interactions

  • Integration of phenotypic data with expression patterns

  • Comparison with orthologous proteins in related species

  • Computational modeling to generate testable hypotheses

Tools similar to those used in S. pombe global transcriptional response studies, such as SAM, GeneSpring, and hierarchical clustering with Pearson correlations, can be adapted for this purpose .

What emerging technologies might advance our understanding of SPAC1782.12c?

Several cutting-edge approaches hold promise:

  • Cryo-EM for high-resolution structural determination

  • CRISPR-Cas9 for precise genome editing and conditional regulation

  • Single-cell technologies to examine cell-to-cell variation in expression

  • Protein-lipid interaction analysis using native mass spectrometry

  • Integrative structural biology combining multiple data types

These approaches can overcome limitations of traditional methods, particularly for challenging membrane proteins.

How might studying SPAC1782.12c contribute to broader understanding of conserved cellular processes?

Investigating uncharacterized proteins like SPAC1782.12c can:

  • Reveal novel membrane protein functions conserved across species

  • Identify previously unknown components of fundamental cellular pathways

  • Provide insights into membrane protein evolution

  • Discover new regulatory mechanisms in S. pombe with potential relevance to other organisms

  • Establish new connections between membrane dynamics and established cellular processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.