Recombinant Schizosaccharomyces pombe UPF0494 membrane protein C1348.01 (SPBC1348.01)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Schizosaccharomyces pombe UPF0494 membrane protein C1348.01 is a full-length protein expressed in Schizosaccharomyces pombe (strain 972/ATCC 24843), a model organism for studying eukaryotic cell biology. The protein is classified under the UPF0494 family, which includes uncharacterized membrane proteins conserved in fungi .

PropertyDetail
Uniprot IDP0CS86
Gene NameSPBC1348.01
Expression RegionAmino acids 1-269
Molecular CharacteristicsPredicted transmembrane domains with cytoplasmic/non-cytoplasmic regions
TagDetermined during production (commonly His-tag or GST for purification)
Storage BufferTris-based buffer with 50% glycerol

Production and Quality Control

Produced as a recombinant protein, it is optimized for stability and solubility:

  • Expression System: Schizosaccharomyces pombe (ensures proper post-translational modifications).

  • Purity: >90% by SDS-PAGE (data inferred from standard production protocols).

  • Storage: Stable at -20°C short-term; long-term storage at -80°C recommended .

Limitations and Future Directions

No peer-reviewed studies specifically addressing SPBC1348.01’s function were identified in available sources. Current data rely on vendor specifications and sequence-based predictions. Critical next steps include:

  • Experimental Validation: Subcellular localization assays (e.g., GFP tagging).

  • Functional Assays: Transport activity screening using radiolabeled substrates.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPBC1348.01; UPF0494 membrane protein C1348.01
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC1348.01
Target Protein Sequence
MSNPESLKKQVEPPGYNELFMVEDVCNVDLEQGLDLCKPEKVNKQSQRSRQSRQSLFTNT IKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPDGRISTRSNFRWPLLIIWSIIIVFA VDKKFEVQKFLSIWINENRFYSEIWVPIAIYVCLLVLMLLSLIFFAEFAVLALRVTGVII AVLGMIIAVLGMIIAALGATITGLLYFGHWALYKLVILSLGFKIVTPGDVCVSNTLPTHN GETALHSETTVGSDIEQIELQNMPTPVKK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0494 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is UPF0494 membrane protein C1348.01 and what organism does it originate from?

UPF0494 membrane protein C1348.01 is a membrane protein from Schizosaccharomyces pombe (strain 972 / ATCC 24843), commonly known as fission yeast. This protein is encoded by the gene SPBC1348.01 and has been classified in the UPF0494 protein family. The full amino acid sequence consists of 269 amino acids, as documented in the UniProt database (UniProt accession: P0CS86) . This protein is part of a broader family of membrane proteins with similar structural characteristics found across various species, though their precise functions remain under investigation in current research.

What are the optimal storage conditions for recombinant SPBC1348.01?

For optimal stability and activity maintenance of recombinant SPBC1348.01, the following storage conditions are recommended:

  • Primary storage: -20°C for regular use, or -80°C for extended long-term storage

  • Storage buffer: Tris-based buffer with 50% glycerol, specifically optimized for this protein

  • Working aliquots: Store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein stability and activity

How is SPBC1348.01 expression regulated during meiosis?

SPBC1348.01 expression shows significant regulation during meiosis, particularly in relation to the Cuf2 transcription factor. Research has demonstrated that SPBC1348.01 transcript levels are altered in cuf2Δ/cuf2Δ mutant strains, suggesting that Cuf2 plays a role in regulating this gene during meiotic development .

Ten hours after meiotic induction, RNA analysis revealed that SPBC1348.01 transcript levels, along with SPAC1B2.03c+, wtf13+, and meu14+ transcripts, show differential expression in cuf2Δ/cuf2Δ mutant strains compared to wild-type . This regulation pattern indicates that SPBC1348.01 is part of a meiosis-specific gene expression program controlled by the Cuf2 regulatory factor.

For experimental detection of SPBC1348.01 transcripts, researchers commonly use a riboprobe spanning positions +241 to +435 relative to the initiator codon, with a total length of 195 base pairs, as outlined in the following table:

Gene IDGene nameRiboprobe length (bp)Position relative to initiator codon
SPBC1348.01+-195+241 to +435

What is the difference between SPBC1348.01 and the related UPF0494 membrane protein PB2B2.14c?

While both SPBC1348.01 (UniProt: P0CS86) and PB2B2.14c (UniProt: Q9HDU1) belong to the UPF0494 family of membrane proteins in Schizosaccharomyces pombe, they exhibit several key differences:

  • Sequence length: SPBC1348.01 consists of 269 amino acids , whereas PB2B2.14c is shorter with 230 amino acids .

  • Amino acid composition: While they share similar domain architecture as membrane proteins, their sequences have distinguishing features:

    • SPBC1348.01 begins with "MSNPESLKKQVEPPGY..."

    • PB2B2.14c begins with "MVRDTRNVDLEWGLELC..."

  • Gene location: They are encoded by different loci within the S. pombe genome (SPBC1348.01 and SPBPB2B2.14c respectively).

  • Potential functional differences: Though both belong to the same protein family, their sequence differences suggest possible specialized functions that require further investigation.

These differences highlight the importance of precise identification when working with members of the UPF0494 protein family to ensure experimental reproducibility and accurate interpretation of results.

What are the recommended approaches for detecting SPBC1348.01 expression in genetic studies?

For robust detection of SPBC1348.01 expression in genetic studies, RNA-based methods have proven particularly effective. Based on published methodologies, the following approach is recommended:

  • RNA Isolation:

    • Extract total RNA using the hot phenol method as described in multiple studies

    • Quantify RNA spectrophotometrically to ensure adequate quality and quantity

    • Typical protocols require 15-20 μg of RNA per reaction for downstream applications

  • RNase Protection Assay:

    • Generate antisense riboprobes targeting SPBC1348.01 (positions +241 to +435)

    • Clone DNA templates into vectors such as pBluescript SK

    • Linearize constructs with appropriate restriction enzymes (e.g., BamHI)

    • Label antisense RNA with [α-32P]UTP using T7 RNA polymerase

    • Include act1+ mRNA probing as an internal control for normalization

  • Microarray Analysis:

    • For genome-wide expression studies, hybridize labeled cDNA onto glass DNA microarrays

    • Directly incorporate Cy3 and Cy5-dCTP using reverse transcriptase

    • Scan arrays using a laser scanner (e.g., GenePix 4000B)

    • Filter unreliable signals and normalize data using appropriate software

    • A gene can be classified as differentially expressed if its expression ratio is ≥1.5-fold between experimental conditions

These methodologies can be adapted to specific research questions, with the riboprobe design being particularly critical for specificity when examining SPBC1348.01 expression patterns during developmental processes or in response to environmental stimuli.

How should researchers approach experimental design for studying SPBC1348.01 function?

When designing experiments to elucidate SPBC1348.01 function, researchers should employ a systematic approach that addresses the challenges inherent to membrane protein characterization:

  • Pathway Mapping Strategy:

    • Construct a consistent and explanatory pathway diagram that incorporates SPBC1348.01

    • Recognize that canonical pathway schemes may be insufficient and require refinement

    • Include thorough literature research and logical argumentation to resolve potential contradictions

    • Design decisive experiments to test specific hypotheses about protein function

  • Data Integration Approach:

    • Combine heterogeneous data sources to consolidate knowledge about the pathway

    • Develop small models focused on well-defined sub-questions rather than attempting to model the full pathway immediately

    • Incorporate time-course data when available to capture dynamic behaviors

    • Integrate online databases and high-throughput studies for comprehensive analysis

  • Experimental Considerations:

    • Divide data generation into different purposes:

      • Qualitative, roughly sampled western blots on multiple mutants for pathway reconstruction

      • Higher temporal resolution western blots with multiple biological replicates for modeling

    • Consider the challenges of input signal quantification, particularly when dealing with physiological stimuli rather than artificial treatments

    • Address the issue of biological replicate variance, which is common in complex signaling systems

  • Control Selection:

    • Include appropriate genetic controls (e.g., wild-type vs. cuf2Δ/cuf2Δ mutants)

    • Use act1+ as an internal control for normalization in expression studies

    • Consider parallel analysis of related proteins (e.g., SPBPB2B2.14c) to distinguish specific vs. general effects

This comprehensive approach acknowledges the complexity of membrane protein research while providing a methodological framework for generating reliable and interpretable data.

What are the challenges in resolving contradictions in SPBC1348.01 research literature?

Resolving contradictions in the research literature surrounding SPBC1348.01 presents several significant challenges that researchers must navigate:

  • Fragmented Knowledge Base:

    • Literature sources on S. pombe membrane proteins are often fragmented and sometimes self-contradicting

    • Resolution of contradictions requires intense discussion among experimental collaborators

    • Maintaining consistency with all demonstrated facts is challenging but essential

  • Unknown Regulatory Mechanisms:

    • Known regulators may be insufficient to explain observed data

    • Some regulators show no effect on downregulation signals or lack transcriptional/post-transcriptional control

    • This necessitates investigation of pathway extensions to identify missing regulatory elements

  • Input Signal Quantification:

    • Using physiological approaches (e.g., nitrogen starvation to induce pheromone secretion) introduces uncertainty about actual signal strength

    • Unknown dynamics of pheromone induction leads to variance among biological replicates

    • This "least artificial" approach creates challenges for quantitative modeling

  • Data Limitations:

    • Time course data on single proteins is often insufficient for comprehensive pathway reconstruction

    • Integration of heterogeneous data types becomes necessary but introduces complexity

    • Balancing between qualitative data (pathway reconstruction) and quantitative data (modeling) requires careful experimental design

To overcome these challenges, researchers should:

  • Employ formal frameworks for network reconstruction where possible

  • Consider Bayesian methods while acknowledging their limitations with biological data

  • Perform manual inspection of data to identify links that automated algorithms might miss

  • Design experiments specifically to resolve critical contradictions in the literature

What statistical methods are appropriate for analyzing SPBC1348.01 expression data?

When analyzing expression data for SPBC1348.01, researchers should employ robust statistical methods that account for the specific characteristics of membrane protein expression data:

  • Microarray Data Analysis:

    • After scanning arrays, analyze using specialized software (e.g., GenePix pro)

    • Filter unreliable signals using established cut-off criteria

    • Normalize data using customized scripts (e.g., Per1 script)

    • Discard genes that do not yield reproducible results between trials

    • Similarly, discard genes for which 50% of the data points are missing

    • Complete data acquisition, processing, and normalization using software such as GeneSpring GX

  • Expression Ratio Analysis:

    • Export normalized signals to spreadsheet software (e.g., Microsoft Excel)

    • Average expression ratios from biological repeat experiments

    • Consider a gene as differentially regulated if its expression is up- or down-regulated ≥1.5-fold in experimental conditions compared to control

  • Advanced Statistical Approaches:

    • For network reconstruction, consider but carefully evaluate Bayesian algorithms

    • Be aware that even in data-rich setups, Bayesian network reconstruction may yield only partial reconstruction of known pathways

    • Compare results from automated algorithms with manual inspection of data to identify potentially missed relationships

  • Handling Biological Variance:

    • Acknowledge the inherent variance in biological replicates, particularly in systems using physiological rather than artificial stimulation

    • Perform sufficient biological replicates (minimum three) to account for this variance

    • Use appropriate internal controls (e.g., act1+) for normalization

By employing these statistical approaches, researchers can extract meaningful insights from expression data while acknowledging the limitations and challenges inherent to biological systems.

How does SPBC1348.01 function compare to homologous proteins in other model organisms?

Comparing SPBC1348.01 to homologous UPF0494 family proteins across model organisms reveals important evolutionary and functional insights:

When conducting comparative studies, researchers should focus on:

  • Identifying true orthologs versus paralogs

  • Distinguishing between conserved functional domains and variable regions

  • Correlating expression patterns with developmental or environmental responses across species

  • Testing functional conservation through heterologous expression experiments

What experimental systems are most suitable for functional characterization of SPBC1348.01?

For effective functional characterization of SPBC1348.01, researchers should consider multiple complementary experimental systems:

  • Genetic Modification Approaches:

    • Gene deletion (knockout) studies in S. pombe to assess phenotypic consequences

    • Point mutation analysis of conserved residues to identify functionally critical domains

    • Conditional expression systems (e.g., thiamine-repressible promoters) for studying essential functions

    • Comparative analysis with related knockouts (e.g., cuf2Δ/cuf2Δ mutants) to establish regulatory relationships

  • Protein Localization Studies:

    • Fluorescent protein tagging (e.g., GFP fusion) to determine subcellular localization

    • Co-localization experiments with known membrane compartment markers

    • Time-lapse imaging during meiosis to capture dynamic localization changes

    • Electron microscopy for high-resolution structural context

  • Protein-Protein Interaction Analysis:

    • Yeast two-hybrid screening to identify interaction partners

    • Co-immunoprecipitation to validate physiologically relevant interactions

    • Proximity labeling techniques (e.g., BioID) to identify proteins in the same cellular compartment

    • Crosslinking mass spectrometry to map specific interaction interfaces

  • Functional Assays:

    • Membrane integrity assessments in wildtype versus mutant strains

    • Response to various stresses (osmotic, temperature, pH) to identify conditional phenotypes

    • Meiotic progression analysis, given the protein's regulation during meiosis

    • Pathway reconstruction using small models focused on well-defined sub-questions

By combining these approaches, researchers can develop a comprehensive understanding of SPBC1348.01 function in cellular processes, particularly during meiosis where its expression shows specific regulation patterns.

How can researchers effectively model SPBC1348.01 in signaling pathway reconstructions?

Effective modeling of SPBC1348.01 in signaling pathway reconstructions requires a structured approach that addresses the complexities of membrane protein signaling:

  • Multi-tiered Modeling Strategy:

    • Begin with small, focused models addressing specific sub-questions rather than attempting to model the entire pathway

    • These targeted models might include:

      • Pathway induction dynamics

      • Role of protein localization in signaling

      • Specific protein-protein interactions

    • Gradually integrate these smaller models into a more comprehensive framework

  • Data Integration Framework:

    • Incorporate diverse data types:

      • Time-course protein activity measurements

      • Steady-state protein abundance data from high-throughput studies

      • Qualitative data from genetic mutants

      • Cell morphology images when available

    • Weight different data types appropriately based on reliability and relevance

  • Model Refinement Process:

    • Start with qualitative models (e.g., Boolean networks) to establish basic pathway architecture

    • Progress to semi-quantitative models as data quality permits

    • Develop fully quantitative mathematical models only for well-characterized pathway segments

    • Iteratively refine models as new experimental data becomes available

  • Addressing Specific Challenges:

    • Unknown input signal dynamics: Develop methods to estimate pheromone induction dynamics

    • Scarce data: Prioritize experiments to fill critical knowledge gaps

    • Pathway inconsistencies: Use modeling to test alternative hypotheses and resolve contradictions

This structured approach acknowledges the limitations of current knowledge while providing a framework that can evolve as our understanding of SPBC1348.01 and its signaling context improves.

What are the implications of SPBC1348.01 regulation during meiosis for understanding reproductive biology?

The regulation of SPBC1348.01 during meiosis provides significant insights into reproductive biology mechanisms, with implications that extend beyond S. pombe:

  • Meiosis-Specific Regulatory Networks:

    • The regulation of SPBC1348.01 by the Cuf2 transcription factor demonstrates its integration into meiosis-specific gene expression programs

    • Along with other genes (SPAC1B2.03c+, wtf13+, meu14+), SPBC1348.01 shows altered expression in cuf2Δ/cuf2Δ mutants

    • This suggests a coordinated regulatory network specifically activated during sexual reproduction

  • Evolutionary Conservation Implications:

    • As a simple eukaryotic model, S. pombe provides insights into fundamental meiotic processes

    • Understanding the regulation and function of SPBC1348.01 may reveal conserved mechanisms relevant to reproductive biology across species

    • Membrane proteins often play critical roles in gamete recognition, fusion, and development

  • Developmental Timing Control:

    • The precise regulation of SPBC1348.01 during meiosis suggests its involvement in stage-specific processes

    • Ten hours after meiotic induction appears to be a critical timepoint for expression regulation

    • This temporal specificity indicates potential roles in middle or late meiotic events

  • Research Applications:

    • Investigating SPBC1348.01 function may provide insights into meiotic abnormalities and reproductive disorders

    • The protein could represent a potential target for contraceptive development or reproductive technology

    • Understanding its role in membrane dynamics during meiosis could inform research on gamete fusion mechanisms

By exploring the specific roles of SPBC1348.01 during meiosis, researchers gain valuable insights into the molecular underpinnings of sexual reproduction, with potential applications in reproductive medicine and biotechnology.

What are the current limitations in SPBC1348.01 research and how might they be addressed?

Current SPBC1348.01 research faces several significant limitations that researchers should acknowledge and address:

  • Incomplete Functional Characterization:

    • Despite identification and sequence characterization, the precise cellular function remains incompletely understood

    • Addressing this requires:

      • Comprehensive phenotypic analysis of deletion/mutation strains

      • Identification of interaction partners and signaling networks

      • Integration of SPBC1348.01 into known cellular pathways

  • Technical Challenges with Membrane Proteins:

    • As a membrane protein, SPBC1348.01 presents inherent difficulties for structural and biochemical studies

    • Potential solutions include:

      • Advanced cryo-EM techniques optimized for membrane proteins

      • Nanodiscs or other membrane mimetics for in vitro studies

      • Computational prediction methods to inform experimental design

  • Data Scarcity:

    • Limited time-course data is available for comprehensive pathway modeling

    • To overcome this limitation:

      • Generate higher temporal resolution data for key processes

      • Develop experimental pipelines to measure multiple parameters simultaneously

      • Combine qualitative data from multiple mutants with quantitative data from focused experiments

  • Unknown Regulatory Mechanisms:

    • Current knowledge of regulators is insufficient to explain all observed phenomena

    • Research should focus on:

      • Identifying additional regulators beyond Cuf2

      • Characterizing post-transcriptional and post-translational regulation

      • Developing more precise tools to quantify input signals for pathway stimulation

  • Methodological Approaches:

    • Formal frameworks for network reconstruction have shown limitations with real biological data

    • Researchers should:

      • Combine automated algorithms with manual data inspection

      • Develop hybrid approaches that integrate qualitative insights with quantitative measurements

      • Design decisive experiments specifically to distinguish between alternative hypotheses

Addressing these limitations requires collaborative efforts across disciplines, combining expertise in genetics, biochemistry, computational biology, and systems biology to develop a comprehensive understanding of SPBC1348.01 function and regulation.

How does understanding SPBC1348.01 contribute to the broader field of membrane protein research?

Research on SPBC1348.01 makes several important contributions to the broader field of membrane protein research:

  • Model System Advantages:

    • S. pombe represents an ideal model organism for membrane protein studies due to:

      • Well-characterized genetics and molecular biology

      • Simpler eukaryotic cell architecture compared to mammalian systems

      • Conservation of fundamental membrane biology processes

      • Tractability for experimental manipulation

    • Insights from SPBC1348.01 studies can inform approaches for studying more complex membrane proteins

  • Methodological Advancements:

    • Challenges encountered in SPBC1348.01 research drive development of:

      • Improved expression and purification protocols for membrane proteins

      • Novel analytical techniques for membrane protein characterization

      • Better computational models for predicting membrane protein structure and function

      • More sophisticated network reconstruction approaches

  • Evolutionary Insights:

    • As a member of the UPF0494 protein family, SPBC1348.01 research contributes to:

      • Understanding evolutionary conservation of membrane protein functions

      • Identifying species-specific adaptations in membrane biology

      • Mapping the diversification of membrane protein families across phylogeny

      • Recognizing fundamental design principles in biological systems

  • Pathway Integration Frameworks:

    • Studies on SPBC1348.01 regulation during meiosis demonstrate:

      • How membrane proteins integrate into complex signaling networks

      • Temporal coordination of membrane protein expression with developmental processes

      • Control mechanisms that ensure appropriate membrane protein function

      • The importance of considering membrane compartmentalization in signaling

By advancing our understanding of SPBC1348.01, researchers contribute valuable insights and methodologies to the broader membrane protein research field, potentially informing approaches to studying clinically relevant membrane proteins in more complex organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.