Recombinant Schizosaccharomyces pombe UPF0494 membrane protein C1348.07 (SPBC1348.07) is a protein expressed by the fission yeast Schizosaccharomyces pombe . S. pombe serves as a model organism to study fundamental biological processes, including the function and architecture of the nuclear pore complex (NPC) .
The amino acid sequence for Recombinant Schizosaccharomyces pombe UPF0494 membrane protein C1348.07 (SPBC1348.07) is as follows :
MDDLKIKNSIQVNVSLMSASSLNSDSDSDSISSQSDLEKGLDICKPEKVNKQSQRSRQSRQS LFTNTIKPQKDKMNIKSDKIKDFLNDPFTEFSKFHNSYYPDGRISTRSNFRWPLLIIWSIII IFAVDKKFEVQKFLSIWINENRFYSEIWVPIAIYVCLLVLMLLSLIFFAEFAVLALRVTGVI IAVLGAILGMIIAVLGMIIAALGMIIAALGATITGLLYFGHWALYKLVILSLGFKIVTPGDVC VSNTLPTHNGETALHSETTVGSDK
The Schizosaccharomyces pombe UPF0494 membrane protein C212.01c/Cpt2r1.04c(SPAC212.01c) has several biochemical functions and interacts directly with proteins and molecules .
Schizosaccharomyces pombe is used in the analysis of the composition of the NPC through tagging individual nucleoporins with GFP . Fluorescence measurements of GFP-fused nucleoporins help estimate the composition of the NPC in S. pombe .
Recombinant forms of this protein are available for research purposes . These recombinant proteins are typically produced in Schizosaccharomyces pombe and can be used in various applications, including ELISA assays .
Proteasome Studies: Research has been conducted on the proteasome subunit Rpn7 in Schizosaccharomyces pombe, contributing to the understanding of proteasome assembly and function .
Heme Assimilation: The Shu1 protein, involved in heme assimilation in Schizosaccharomyces pombe, requires cell-surface localization for its function .
Natural Compound Biosynthesis: Streptomyces strains have been identified and characterized for their potential in producing bioactive natural products, including antibiotics .
KEGG: spo:SPBC1348.07
STRING: 4896.SPBC1348.07.1
SPBC1348.07 is classified as a membrane protein belonging to the UPF0494 family . Computational topology analysis indicates it contains multiple transmembrane domains as evidenced by the hydrophobic amino acid stretches in its sequence, particularly in regions such as "WPLLIIWCILIVFAID" and "LFILLLLGLIYCSK" . The protein appears to adopt a multi-pass membrane topology, characteristic of integral membrane proteins.
Experimental localization studies have not been extensively published specifically for this protein, but bioinformatic predictions based on its sequence suggest plasma membrane localization. Researchers investigating this protein should consider fluorescent protein tagging approaches for definitive localization studies, preferably using C-terminal tags to minimize interference with potential N-terminal sorting signals.
For recombinant expression of SPBC1348.07, E. coli has been successfully employed as a host system, as evidenced by commercially available recombinant versions of the protein . When expressing this membrane protein in E. coli, consider the following optimization strategies:
Expression vector selection: Vectors containing strong inducible promoters (T7, tac) with tight regulation are recommended to control expression levels.
Strain selection: E. coli strains optimized for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3), often yield better results than standard BL21(DE3).
Induction conditions: Use lower temperatures (16-25°C) and reduced inducer concentrations to slow protein production and facilitate proper membrane insertion.
Fusion tags: His-tags have been successfully employed , but consider using fusion partners like MBP or SUMO to enhance solubility if expression yields are low.
For studies requiring native post-translational modifications or functional analysis, homologous expression in S. pombe might provide advantages. The well-characterized S. pombe genome and extensive genetic tools make it an excellent model system for studying protein function in its native context .
Based on available product information, recombinant SPBC1348.07 stability can be maximized under the following storage conditions:
Short-term storage (up to one week): Maintain aliquots at 4°C in appropriate buffer systems .
Medium-term storage: Store at -20°C in a buffer containing stabilizing agents .
Long-term storage: Maintain at -80°C in buffer containing cryoprotectants such as 50% glycerol .
The recommended storage buffer composition includes:
Tris-based buffer system (typically 20-50 mM, pH 7.5-8.0)
50% glycerol as a cryoprotectant
To prevent protein degradation and loss of activity:
Avoid repeated freeze-thaw cycles, which can significantly impact protein integrity
Prepare small working aliquots to minimize freeze-thaw events
Include protease inhibitors if maintaining for extended periods at 4°C
The UPF0494 designation indicates this protein belongs to a family of uncharacterized proteins with unknown function. Systematic approaches to functional characterization include:
Comparative genomics analysis: S. pombe shares significant orthology with human genes (>70% of protein-coding genes have human orthologs) , making comparative analysis valuable for predicting function through evolutionary conservation patterns.
Gene knockout/knockdown studies: Generate SPBC1348.07 deletion strains in S. pombe to observe phenotypic changes. Techniques like those used in Bulk Segregant Analysis studies can be adapted to identify phenotypes associated with SPBC1348.07 deletion .
Protein-protein interaction studies:
Yeast two-hybrid screening
Co-immunoprecipitation followed by mass spectrometry
Proximity-based labeling approaches (BioID, APEX)
Subcellular localization studies: Generate fluorescently tagged versions of SPBC1348.07 to determine precise cellular localization, which can provide functional insights.
Transcriptomics/proteomics profiling: Compare gene/protein expression profiles between wild-type and SPBC1348.07 mutant strains under various conditions.
The systematic application of these approaches can overcome the challenges posed by studying proteins of unknown function. When interpreting results, consider that membrane proteins often function in signaling, transport, or structural roles.
S. pombe offers several sophisticated genomic engineering approaches for studying SPBC1348.07:
CRISPR-Cas9 system: While traditionally challenging in S. pombe due to its efficient non-homologous end joining (NHEJ) repair, optimized protocols now exist. Design guide RNAs targeting SPBC1348.07 and include homology-directed repair templates for precise genetic modifications.
Homologous recombination: S. pombe exhibits efficient homologous recombination, making it possible to:
Create gene deletions (knockout)
Introduce point mutations
Add epitope tags or fluorescent proteins to study localization and interactions
Promoter replacement: Replace the native promoter with regulatable promoters (e.g., nmt1) to control expression levels and study the effects of over- or under-expression.
Degron tagging: Fusion with auxin-inducible degron tags allows rapid, conditional protein depletion to study acute loss-of-function effects.
When designing genomic modifications, consider S. pombe's distinct genomic features:
These features affect primer design, modification strategies, and interpretation of phenotypic effects.
Determining the membrane topology of SPBC1348.07 requires combining computational prediction with experimental verification:
Computational analysis:
Use transmembrane prediction algorithms (TMHMM, HMMTOP, Phobius)
Apply hydropathy analysis (Kyte-Doolittle plots)
Employ topology prediction tools (TOPCONS, MEMSAT)
Experimental approaches:
Protease protection assays: Differentially digest protein regions exposed to cytoplasmic or extracellular/lumenal environments
Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and assess accessibility to membrane-impermeable thiol-reactive reagents
Epitope insertion and antibody accessibility: Insert epitope tags at predicted loops and determine accessibility in intact versus permeabilized cells
Glycosylation mapping: Insert glycosylation sites at predicted extracellular/lumenal loops and assess glycosylation status
Advanced structural techniques:
Cryo-electron microscopy
X-ray crystallography (challenging for membrane proteins)
Solid-state NMR
When designing topology experiments, consider the predicted membrane-spanning regions in SPBC1348.07's sequence, particularly hydrophobic stretches that may form transmembrane helices. The analysis of these results should be integrated with bioinformatic predictions to develop a comprehensive topology model.
As a membrane protein, SPBC1348.07 presents inherent solubility challenges. Implement these strategies to improve solubility and stability:
Detergent screening: Test multiple detergent types to identify optimal solubilization conditions:
| Detergent Class | Examples | Advantages |
|---|---|---|
| Non-ionic | DDM, LMNG, Triton X-100 | Mild, preserve protein-protein interactions |
| Zwitterionic | CHAPS, FC-12 | Efficient solubilization, moderate denaturation |
| Polymers | Amphipols, SMALPs | Maintain native lipid environment |
Buffer optimization:
Screen pH ranges (typically 6.5-8.5)
Test various salt concentrations (100-500 mM)
Include stabilizing additives (glycerol, specific lipids, cholesterol)
Protein engineering approaches:
Truncation of disordered regions
Fusion to solubility-enhancing tags (MBP, SUMO)
Surface mutation of exposed hydrophobic residues
Alternative membrane mimetics:
Nanodiscs
Liposomes
Bicelles
Co-expression with stabilizing partners:
Lipids
Interacting proteins
Chaperones
Document all conditions systematically, as membrane protein behavior can be highly dependent on specific solubilization and purification conditions.
S. pombe offers distinct advantages for membrane protein research compared to other model systems:
Genomic advantages:
Experimental advantages:
Efficient homologous recombination for genome editing
Rod-shaped cells facilitate morphological analysis
Growth by medial fission produces equal-sized daughter cells, simplifying cell cycle studies
Well-established genomic and proteomic resources
Conserved cell cycle regulation mechanisms shared with higher eukaryotes
Membrane biology relevance:
Eukaryotic membrane composition similar to higher organisms
Post-translational modification machinery present
Conserved membrane trafficking pathways
Presence of membrane microdomains analogous to mammalian lipid rafts
When designing experiments with SPBC1348.07, leverage S. pombe's genomic tractability and the considerable similarity between its cellular processes and those of human cells. This makes findings potentially more translatable to understanding human membrane protein biology compared to bacterial or some other yeast expression systems.