Recombinant Schizosaccharomyces pombe UPF0494 membrane protein C212.04c (SPAC212.04c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. If you have specific format requirements, kindly indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
As a default, all proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. The default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
SPAC212.04c; UPF0494 membrane protein C212.04c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC212.04c
Target Protein Sequence
MSNPESLKKQVEPPGYNELFMVEDVCNVDLEQGLDLCKPEKVNKQSQRSRQSRQSLFTNT IKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPNGRISTQDKSRWVLLIIWSIITILT IDKKFKIKESYLEWIGENQSHSEIWGPIVIYVGLFILLLSAFNYCSKLIIKALPLISMVI AWVGVVIAAFSVIITATIAGVIAAFSVIITATIAGVIAAMVGILYFGHWLVYKILILAFG FKIVTSGDVCVSNTLPTHNGETALHSDATVGSDIEQIELQNMPTPVKK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0494 family
Subcellular Location
Cytoplasm. Endoplasmic reticulum. Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is SPAC212.04c and what are its basic characteristics?

    SPAC212.04c is a UPF0494 family membrane protein found in Schizosaccharomyces pombe (fission yeast). The full-length protein consists of 288 amino acids and is characterized as a membrane-localized protein . As a member of the UPF0494 family, it shares structural similarities with other membrane proteins in this group, though its precise function is still being investigated.

    Key characteristics of SPAC212.04c include:

    • Full protein length: 288 amino acids

    • Contains membrane-spanning domains

    • Shows association with stress response pathways (Up-stress value: 0.185)

    • Exhibits Swi6-binding properties (Swi6-bound value: 1.883)

  • How is recombinant SPAC212.04c typically expressed and purified for research purposes?

    Recombinant SPAC212.04c is commonly expressed in E. coli expression systems with a histidine tag to facilitate purification . The methodological approach typically involves:

    1. Cloning the SPAC212.04c gene into an appropriate expression vector

    2. Transforming the construct into E. coli cells

    3. Inducing protein expression (often using IPTG for T7 promoter-based systems)

    4. Cell lysis using methods compatible with membrane proteins

    5. Purification via Nickel-NTA affinity chromatography using the His-tag

    6. Optional: further purification steps like size exclusion chromatography

    7. Buffer optimization for stability of the membrane protein

    The purified protein is typically stored in Tris-based buffers with 50% glycerol at -20°C to maintain stability, similar to other S. pombe membrane proteins .

  • What experimental techniques are commonly used to study SPAC212.04c localization and expression?

    Several techniques are employed to study the localization and expression of SPAC212.04c:

    Localization Studies:

    • Fluorescent tagging (GFP, mCherry) for live cell imaging

    • Immunofluorescence microscopy with specific antibodies

    • Subcellular fractionation followed by Western blotting

    Expression Analysis:

    • Quantitative real-time PCR (qRT-PCR) to measure mRNA levels

    • RNA sequencing (RNA-seq) for transcriptome-wide analysis

    • Western blotting for protein expression levels

    • Chromatin immunoprecipitation (ChIP) to study transcription factor binding at the SPAC212.04c promoter

    Expression data from studies shows:

    • Swi6-binding association: 1.883

    • Stress response correlation: 0.185

Advanced Research Questions

  • How does SPAC212.04c expression change during cellular stress responses, and what methodologies best capture these dynamics?

    SPAC212.04c shows modest upregulation during stress conditions (Up-stress value: 0.185) . To effectively study these dynamics:

    Recommended methodologies:

    1. Time-course experiments - Monitor expression changes using RNA-seq or qRT-PCR at multiple time points following stress induction (heat, oxidative, nutrient limitation)

    2. Single-cell analysis - Use fluorescent reporters fused to the SPAC212.04c promoter to capture cell-to-cell variation

    3. MultiRNAflow analysis - Apply temporal clustering methods to identify co-regulated genes

    4. Proteomics approaches - Quantitative mass spectrometry to measure protein-level changes

    Experimental design considerations:

    • Include appropriate stress controls and unstressed baselines

    • Use strain background controls to account for genetic variations

    • Consider multiple stress conditions to determine specificity of response

    • Implement both acute and chronic stress exposures to distinguish immediate vs. adaptive responses

  • What is the relationship between SPAC212.04c and heterochromatin formation through Swi6 binding?

    SPAC212.04c demonstrates significant Swi6-binding association (value: 1.883) , suggesting potential involvement in heterochromatin formation or regulation. Swi6 is the S. pombe homolog of Heterochromatin Protein 1 (HP1), a key component in heterochromatin establishment and maintenance.

    Research approaches to investigate this relationship:

    1. ChIP-seq analysis - Determine precise Swi6 binding patterns at the SPAC212.04c locus

    2. Genetic interaction studies - Create double mutants with Swi6 and SPAC212.04c to assess epistatic relationships

    3. Heterochromatin spreading assays - Measure silencing of reporter genes near SPAC212.04c in wild-type vs. mutant backgrounds

    4. DNA methylation analysis - Assess epigenetic modifications at the locus

    Relevant data from published research:

    Studies of Swi6-bound genes show that SPAC212.04c clusters with other heterochromatic regions, suggesting a role in genome organization or expression regulation during stress .

  • How can researchers effectively study the function of SPAC212.04c using gene deletion and complementation approaches?

    Studying SPAC212.04c function through gene deletion and complementation requires:

    Gene deletion strategy:

    1. Design targeting constructs with selectable markers flanked by SPAC212.04c homology regions

    2. Transform S. pombe using lithium acetate method or electroporation

    3. Select transformants on appropriate media

    4. Confirm deletion by PCR, Southern blotting, or sequencing

    5. Assess phenotypes across various conditions (temperature, nutrients, stressors)

    Complementation approaches:

    1. Clone wild-type SPAC212.04c into expression vectors with native or regulatable promoters

    2. Create site-directed mutants of key residues to test functional hypotheses

    3. Introduce constructs into deletion strains

    4. Assess restoration of wild-type phenotypes

    5. Consider chromosomal integration vs. plasmid-based expression

    Critical controls:

    • Empty vector controls

    • Wild-type strain backgrounds

    • Quantification of expression levels in complemented strains

    Researchers should note that genome-wide deletion screens have identified SPAC212.04c in the context of cytoplasmic freezing (CF) phenotypes, suggesting potential roles in stress adaptation .

  • What role might SPAC212.04c play in quiescence and cellular adaptation to nutrient limitation?

    SPAC212.04c may be involved in cellular adaptation to nutrient limitation similar to other membrane proteins in S. pombe. Studies investigating quiescence in fission yeast provide methodological frameworks for examining SPAC212.04c's role:

    Experimental approaches:

    1. Nitrogen starvation experiments - Monitor SPAC212.04c expression during nitrogen depletion-induced quiescence

    2. Glucose limitation studies - Assess protein localization and abundance during glucose starvation

    3. Cytoplasmic freezing (CF) analysis - Evaluate SPAC212.04c deletion impacts on cytoplasmic mobility during starvation

    4. Long-term survival assays - Measure chronological lifespan of deletion strains vs. wild-type

    Key considerations:

    • Temporal profiling is essential as adaptation occurs in distinct phases

    • Cell density and culture conditions must be carefully controlled

    • HIRA complex components interact with specific genes during quiescence and may regulate SPAC212.04c

    • Analysis should include assessment of classic quiescence markers alongside SPAC212.04c-specific observations

  • How does SPAC212.04c interact with the transcriptional regulatory network in S. pombe, and what techniques best elucidate these relationships?

    SPAC212.04c's interaction with transcriptional networks can be investigated using several advanced approaches:

    Recommended techniques:

    1. ChIP-sequencing - Identify transcription factors binding to SPAC212.04c's promoter

    2. DNA affinity purification sequencing (DAP-seq) - Map protein-DNA interactions in vitro

    3. Genetic screens - Identify synthetic interactions with known transcription regulators

    4. Transcriptome analysis - Compare RNA-seq profiles between wild-type and deletion strains

    S. pombe transcription factor data relevant to SPAC212.04c:
    The comprehensive S. pombe atlas of physical interactions has mapped TF binding across the genome, providing context for understanding SPAC212.04c regulation . The TFexplorer webtool allows researchers to explore these interactions interactively.

    Gene expression patterns:
    SPAC212.04c exhibits expression patterns that may be influenced by:

    • Swi6 binding (heterochromatin regulation)

    • Stress response pathways

    • Cell cycle progression

    • Nutritional status

  • What methods can be used to investigate the membrane topology and protein-protein interactions of SPAC212.04c?

    Membrane topology analysis:

    1. Cysteine scanning mutagenesis - Introduce cysteine residues at various positions and assess accessibility to membrane-impermeable reagents

    2. GFP-fusion analysis - Create N- and C-terminal fusions to determine orientation

    3. Protease protection assays - Treat membrane preparations with proteases to determine exposed domains

    4. Computational prediction - Use algorithms like TMHMM, Phobius, or TopPred to predict transmembrane domains

    Protein-protein interaction methods:

    1. Yeast two-hybrid (membrane-based variants) - Modified for membrane proteins

    2. Co-immunoprecipitation - Using epitope-tagged versions of SPAC212.04c

    3. Proximity labeling - BioID or APEX2 fusions to identify neighboring proteins

    4. FRET/BRET analysis - For in vivo interaction studies

    5. Crosslinking mass spectrometry - To capture transient interactions

    These techniques can help place SPAC212.04c in its functional context within the membrane environment and identify potential interaction partners that might influence its function during stress responses or normal growth.

  • How can researchers study the evolutionary conservation and divergence of SPAC212.04c across fungal species?

    Methodological approaches for evolutionary analysis:

    1. Comparative genomics - Identify orthologs across fungal species using reciprocal BLAST searches

    2. Multiple sequence alignment - Align protein sequences to identify conserved domains and residues

    3. Phylogenetic tree construction - Determine evolutionary relationships using maximum likelihood or Bayesian methods

    4. Synteny analysis - Examine conservation of genomic context around the gene

    5. Functional complementation - Test if orthologs from other species can rescue S. pombe deletion phenotypes

    Key considerations:

    • UPF0494 family proteins show varying degrees of conservation across fungi

    • Membrane proteins often evolve more rapidly than soluble proteins

    • Functional conservation may exist despite sequence divergence

    • Analysis should include both closely related Schizosaccharomyces species and more distant fungi to establish conservation patterns

    Evolutionary studies can provide insights into the functional importance of specific domains and potentially identify critical residues for targeted mutagenesis experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.